1 2 3 4 5 6 7 8 9 ... 24 25 26 27 28 29 30 31 32 33

Sort by : ReleasedNameDownloadsAddedRatingRelevance
PrintConductor

Freeware by fCoder Group, Inc.
45 x 2333Kb downloads

...each file separately in the applications used to create them. Once you tell it which files to...the process. Print Conductor is easy to use. Create a list of files to be printed. All...
 
batch file printingdxfbatch document printingbatch printingdocumentsvsdpdfdwgcadautomatebatch pdf printingautomationxls
3DBrowser Light Edition

Shareware by Mootools
105 x 51078Kb downloads

Free Vista Files award
...using fade in-out transition. Executable slides show feature: Create a compact application, which contains your slides. Associate...
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
Falco Image Studio

Freeware by Falco Software Company
48 x 21798Kb downloads

...Graphics Tool to create, edit and export images. Create professional looking images with ease. Key features: 1....
 
image studiofalco image editorfalco image studio
CyberLat Screen Saver

Freeware by CyberLat
26 x 1744Kb downloads

...personalize it to fit your feels and emotions. Create as many Screen Saver themes of your own,...PSD (single layer), PSP (single layer), TGA, TIF, TIFF -This program is available in different languages since...
 
stretchprotectormidiscreensavermp3cyberlatinoslide showpantallaimagesdisplaytransition
Picture Viewer .EXE

Shareware by SoftTech InterCorp
52 x 2377Kb downloads

...the internet, digital cameras, photo galleries or scanners. Create and run slideshow presentations, browse folders and directories,...PictureViewer .EXE ideal for presentations. To manage and create custom presentations, enque individual images, single folders or...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Kalimages Basic

Freeware by Soft Experience
31 x 3267Kb downloads

...by keywords or any other information, analyse occurrences, create XML or HTML outputs even integrate with FOP...processor for PDF creation. Thumbnails for : JPEG, TIFF not compressed, PSD (Photoshop), BMP, GIF, PNG, etc....on file name and IPTC fields for: JPEG, TIFF not compressed, PSD (Photoshop). Kalimages Basic is a...
 
generate thumbnailsiptc metadata extractioniimcaption-editingcapture iptckalimages basicdigital photosphoto collectionannotationsphotographersfind imagesphoto softwarecatalog photosfind photos
WildBit Viewer

Freeware by Marko Hietanen
12 x 7267Kb downloads

...Info with Image EXIF meta data JPEG and TIFF support and IPTC (IIMV4) information (like PhotoShop file...and load list later on and you can create custom show in to Slide Show also that...
 
compacteditorslide showfast image viewer
PaintStar

Freeware by Zhenzhou Wang
65 x 2640Kb downloads

...Image Morphing supported. With this technique, you can create a sequence of intermediate frames that seamlessly transform...
 
freewaremorphlayerpathscreen captureimage editor
Hugin

Open source by Pablo d`Angelo
34 x 12000Kb downloads

...imaging solely by allowing stitching of HDR floating-point TIFF photos - These images themselves had to be...to the internal photometric model, hugin can now create HDR output from normal exposure bracketed photos. The...all this stuff out, and the stitcher will create OpenEXR or TIFF HDR output files for later...So now with hugin-0.7.0 and enblend-3.2 you can create realistic, photographic panoramas that have no over-exposed or...
 
imagingphotoimagepanoramicpanoramapanorama tools
AutoImager

Shareware by Mystik Media
32 x 18350Kb downloads

Free Vista Files award
...over 150 configurable command-line options, it`s easy to create batch files to automate routine image processing/conversion tasks....
 
batcheditortrimgifwfxawdphotosconverterrotateeditingcropresampleprocesspngconversionbmpiocaicoafptifftgapsdflipsgipspgraphicsjpegmirrorimagesresizepdfjpg
ContextConvert Pro

Shareware by Mystik Media
27 x 9382Kb downloads

...multi-page format to another, extract multi-page images and create a set of individual files, grab the first...
 
converterwavripperdecoderjpgmpegmpgencodericowmvgifoggbmpwmapngtiffmp3psd
Blaze MediaConvert

Shareware by Mystik Media
23 x 13860Kb downloads

Free Vista Files award
...3GP. The Video Constructor combines selected images to create a video in the destination format. The Video...
 
drwpcxcutpltclpmp3ripperfpxbmpgraphicssoundwmapsdjpegencodergifvideocreatejbgdxfdgnmusicimageconvertertiffmpegcgmextractmpgoggpcdpngpbmjpgdcmconstructjbigpctdecoderdcxwavaudiodecompileico

Demo by fCoder Group
15 x 3218Kb downloads

...The program will scan subfolders for image files, create report and delete input files - if you...
 
gifthumbnailconverterimagestiffgraphicsformatpcxbatchviewerdigitalfilewmfbmpjpeg
2Tiff

Demo by fCoder Group, Inc.
19 x 4890Kb downloads

Free Vista Files award
...Batch-convert large numbers of images to TIFF format with blazing speed and reliability using 2TIFFs...images, electronic faxes and document scans? Just use 2TIFF to settle on a single uniform image size...or email - Use OCR software to convert TIFF format images to text files for later processing...you have scores of images to convert into TIFF format. With its feature rich command-line interface, you...source folder and all subfolders for image files.
 
imagestiffwmfbmpformatdigitalgifviewerpcxbatchjpeggraphicsthumbnailfileconverter

Demo by fCoder Group
9 x 3219Kb downloads

...The program will scan subfolders for image files, create report and delete input files - if you...
 
imagesconverterbmptiffviewerthumbnailjpegpcxgraphicsbatchwmfgiffiledigitalformat

Demo by fCoder Group
16 x 3220Kb downloads

...jpeg to png, from gif to png, from tiff to png and so on. The program has...The program will scan subfolders for image files, create report and delete input files - if you...
 
pcxfileconverterviewerthumbnailwmfgifimagesjpegtiffgraphicsbmpbatchformatdigital

Demo by fCoder Group
14 x 2802Kb downloads

Free Vista Files award
...bitmap to jpeg, from gif to jpeg, from tiff to jpeg and so on. The program has...The program will scan subfolders for image files, create report and delete input files - if you...
 
graphicsfilethumbnailpcxviewergifimageswmfbmpconvertertiffformatbatchjpegdigital

Demo by fCoder
11 x 2795Kb downloads

Free Vista Files award
...jpeg to gif, from bitmap to gif, from tiff to gif and so on. The program has...The program will scan subfolders for image files, create report and delete input files - if you...
 
filethumbnailgraphicswmfgifdigitalviewerconverterpcximagesformatbmptiffbatchjpeg

Demo by fCoder Group
11 x 3219Kb downloads

...gif to bmp, from jpeg to bitmap, from tiff to bmp and so on. The program has...The program will scan subfolders for image files, create report and delete input files - if you...
 
formatgifbmpdigitaltiffpcxconverterimagesgraphicsbatchthumbnailwmfjpegviewerfile
MakeGIF

Shareware by Image Tools Group
32 x 1327Kb downloads

Free Vista Files award
...MakeGIF helps you to create GIF- file from command line in batch mode....visual command line processor. You can use pictures created by MS Paint, Adobe Photoshop and dozens of...others programs. Program features: - creates GIF- files from images in BMP, JPEG (JPG),...PSD, PNG, TGA, PCX, WMF, EMF- formats; - creates "constructed images" (type text in this version); -...
 
animation softwarewebmobile phone screensgif animatorwatermarkcreate gifbatch graphics converterhidden watermarksbatch modegifanimationanimated gif editorvisual command line processorimagetools