1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...ASP.NET server controls for developing SQL BLOB & Thumbnail related web applications in the most efficient, organized...Also you can display the image as a thumbnail by setting a checkbox. BlobThumbnail Control will display...a thumbnail and clicking the thumbnail will show a popup window with the full...a file. You can program those controls to create a secured download link so that your visitor...Products like eBooks or softwares.
 
blobupload controldownload controlsqliframe controlblob controlserver controlashx handleraspnetfile controlimage control
NeoPhoto

Freeware by DTLink Software
108 x 3973Kb downloads

Free Vista Files award
...Create an Instant Photo Website. Resize, rotate, crop and organize all of your digital photos into albums. Add captions. Email entire photo albums, automatically resized with captions included. Turning your...
 
publishredeye reductionphotoalbumcameradigitalweb pageorganizeresizepostthumbnailrotatescreen shotgalleryemailimage
...technical skills. Catalog contain power search, categorized navigation, thumbnail viewing, selection basket, products description pages, powerful slide...gives typical edge for business with make you create entire catalog with most issues, you as a...
 
free slide show builderfree catalog builderfree catalog softwarefree photo album softwarefree web catalog makerfree catalog maker
3DBrowser Light Edition

Shareware by Mootools
121 x 51078Kb downloads

Free Vista Files award
...to browse thousands of files thanks to its thumbnails window. You’ll find user friendly features to display...using fade in-out transition. Executable slides show feature: Create a compact application, which contains your slides. Associate...
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
FreeSaver MP3

Freeware by MGShareware
49 x 788Kb downloads

Free Vista Files award
...with full drag and drop support and image thumbnail preview, let you select image and MP3 files....
 
buildercreatorphotosyour ownslide showthemesscreen saversmp3custompersonalizedmakercreateslideshowedit scrscreensavers
...first name, age, country * Zoom of the thumbnail to a bigger size for best preview of...with Online Dating VideoFriends Networkt 2-tier partnership program. Create custom build of the toolbar and promote it...
 
ukranian girlhusbandfriendsdatingrussian girlspouse russian womanwifebrides
Easy Thumbnails

Freeware by Fookes Software
178 x 1038Kb downloads

Free Vista Files award
...Easy Thumbnails is a handy freeware utility for creating accurate...out the results with a convenient built-in viewer. Thumbnails can be created in any existing folder or...or with a right-click of the mouse, display thumbnails in your browser, and even take advantage of...command-line switches to generate thumbnails seamlessly from other programs. You can also save...your thumbnails to a Web page using a HTML template...
 
batch resizingcreatescaledownloadablethumb nailsthumbslanczos3freewarejpeggeneratethumbnailspicturesresamplingjpgeasylosslessimagesresizethumnailsdigitalphotos
PixMatrix

Freeware by Tufala LLC
37 x 5609Kb downloads

...PixMatrix allows you to quickly create web photo albums and web pages. This software...and does not require HTML knowledge. You can create Java animated web pages featuring your digital photos...editor, spell checker, built in batch image editing, thumbnail creation, FTP with presets for the major ISP`s,...
 
free web albumfree image galleryfree photo sharingfree web photo albumfree photo album softwaredigital images
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...the internet, digital cameras, photo galleries or scanners. Create and run slideshow presentations, browse folders and directories,...PictureViewer .EXE ideal for presentations. To manage and create custom presentations, enque individual images, single folders or...image files, viewing directories, folders, custom playlists or thumbnail images. Image editing and management features allow you...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
...webPeddle is an amazingly easy way to create a storefront. It only takes a couple of...chooses. The selection list displays product ID`s, descriptions, thumbnail images, and unit prices. Each item in the...
 
shopping carte-commercestorefront
SWF Live Preview

Freeware by ELTIMA Software GmbH
38 x 1577Kb downloads

...can scan directories and subdirectories for flash files, create and preview thumbnails for SWF files and fetch...You can even choose yourself which frame to create thumbnail from as well as set size of preview....
 
create thumbnails for swfpreview flashswf live previewpreview swf explorerpreview thumbnails for swf
PDF Thumbnail Generator

Shareware by CoolPDF Software Inc
36 x 1000Kb downloads

...Create thumbnail for your existing PDF files. Thumbnail can be generated from a bitmap (.BMP) or...or even a EMF (Encapsulated Meta File). When thumbnails are created and embedded into your PDF files,...you will see the thumbnails displayed on the left column of your PDF...software utility, you can decide whether to show thumbnails when PDF file is opened....
 
displaythumbnailspdfshowdocumentthumbsfile
WildBit Viewer

Freeware by Marko Hietanen
24 x 14873Kb downloads

...interface within blazing fast folder, file list and thumbnail viewer. Viewer includes also Image Info with Image...and TIFF, Thumbview has changeable views, sorting and thumbnail predefined sizes for fast thumbnail size setting. Viewer...and load list later on and you can create custom show in to Slide Show also that...
 
compactslide showeditorfast image viewer
jAlbum

Commercial by JAlbum AB
137 x 10650Kb downloads

Free Vista Files award
...your album Use flexible templates called "skins" to create customized albums in HTML, Flash or any other...
 
web slideshowweb photo albumphoto gallerythumbnail generatorimage editingweb photo indexjava slideshowjava web album generator
...CoolCap is a MDI Picture viewer using a thumbnail gallery to browse for images. CoolCap provides basic...in MS Paint. CoolCap provides multiple ways to create screen shoots, a feature even to save selction...
 
capture screenmdi picture viewericon converter
PaintStar

Freeware by Zhenzhou Wang
88 x 2640Kb downloads

...Image Morphing supported. With this technique, you can create a sequence of intermediate frames that seamlessly transform...which outlines the area to be captured. Displays thumbnail of selected image in Windows Explorer context menu...
 
freewaremorphlayerpathscreen captureimage editor
CDH Image Explorer Pro

Shareware by CDH Productions
30 x 21002Kb downloads

...etc.). Advanced features include: batch format conversion, advanced thumbnailing and thumbnail browser, GIF animation creation, GIF to...image management (delete, rename, copy, move, zip, etc.), create self-extracting EXEs of images, image palette support, mailing,...
 
textprintzoomtwainshapeconverterrotatemirrorbatchclipartthumbnailingresizeeditorcropacquirevideooptimizeviewerflipslideshowprocessingphotoscapturegraphicsanimationspecial paint effectsplayer

Demo by fCoder Group
30 x 3218Kb downloads

...The program will scan subfolders for image files, create report and delete input files - if you...
 
gifthumbnailconverterimagestiffgraphicsformatpcxbatchviewerdigitalfilewmfbmpjpeg
2Tiff

Demo by fCoder Group, Inc.
33 x 4890Kb downloads

Free Vista Files award
...the image - Correct image for color - Create a collage - Combine into multi-page TIFF files...the fine-tuning of TIFF image quality. You can create single-strip or multi-strip tiff files. 2TIFF can be...
 
imagestiffwmfbmpformatdigitalgifviewerpcxbatchjpeggraphicsthumbnailfileconverter

Demo by fCoder Group
22 x 3219Kb downloads

...The program will scan subfolders for image files, create report and delete input files - if you...
 
imagesconverterbmptiffviewerthumbnailjpegpcxgraphicsbatchwmfgiffiledigitalformat