1 2 3 4 5 6 7 8 9 10 11 12

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...ASP.NET server controls for developing SQL BLOB & Thumbnail related web applications in the most efficient, organized...from ImageButton, will behave exactly like a standard image button with extra byte[] type property named BlobData....The image will be rendered from the value of this...byte[] property instead of ImageURL property. Also you can display the image as...a thumbnail by setting a checkbox.
 
blobupload controldownload controlsqliframe controlblob controlserver controlashx handleraspnetfile controlimage control
NeoPhoto

Freeware by DTLink Software
108 x 3973Kb downloads

Free Vista Files award
...Create an Instant Photo Website. Resize, rotate, crop and organize all of your digital photos into albums. Add captions. Email entire photo albums, automatically resized with captions included. Turning your...
 
publishredeye reductionphotoalbumcameradigitalweb pageorganizeresizepostthumbnailrotatescreen shotgalleryemailimage
3DBrowser Light Edition

Shareware by Mootools
121 x 51078Kb downloads

Free Vista Files award
...to browse thousands of files thanks to its thumbnails window. You’ll find user friendly features to display...your 3D and images files. 3DBrowser recognizes more than 60 images, videos,...need such the width and height of your images or the title and the length of your...Mesh subdivision - Slides show >> Open your images or your videos in the built-in viewer. Use...
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
FreeSaver MP3

Freeware by MGShareware
49 x 788Kb downloads

Free Vista Files award
...Show your own images and play your MP3 files as screensaver FreeSaver...You can control the length of time each image is displayed, stretch or shrink the image to...interface with full drag and drop support and image thumbnail preview, let you select image and MP3...and pet photos, or just to display your image collection on idle time. Fully compatible with Windows...
 
buildercreatorphotosyour ownslide showthemesscreen saversmp3custompersonalizedmakercreateslideshowedit scrscreensavers
Easy Thumbnails

Freeware by Fookes Software
178 x 1038Kb downloads

Free Vista Files award
...Easy Thumbnails is a handy freeware utility for creating accurate...thumbnail images and scaled-down/up copies from a wide range of...interface makes it a snap to find your images and select them for processing individually, in groups,...folders, using a simple file selector and built-in image viewer. You can use slider controls to rotate...out the results with a convenient built-in viewer. Thumbnails can be created in any existing folder or..
 
batch resizingcreatescaledownloadablethumb nailsthumbslanczos3freewarejpeggeneratethumbnailspicturesresamplingjpgeasylosslessimagesresizethumnailsdigitalphotos
PixMatrix

Freeware by Tufala LLC
37 x 5609Kb downloads

...PixMatrix allows you to quickly create web photo albums and web pages. This software...and does not require HTML knowledge. You can create Java animated web pages featuring your digital photos...WYSIWYG HTML editor, spell checker, built in batch image editing, thumbnail creation, FTP with presets for the...
 
free web albumfree image galleryfree photo sharingfree web photo albumfree photo album softwaredigital images
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...It has never been easier to view images and pictures on your computer whether your images...the internet, digital cameras, photo galleries or scanners. Create and run slideshow presentations, browse folders and directories,...solution for anything from professional presentations to idle image browsing. PictureViewer .EXE supports a comprehensive spectrum of...integrated MediaView component seamlessly allows you to view images in the right-click menu of the...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
WildBit Viewer

Freeware by Marko Hietanen
24 x 14873Kb downloads

...WildBit Viewer is compact & fast image viewer with slide show and editor. Eye catching...interface within blazing fast folder, file list and thumbnail viewer. Viewer includes also Image Info with Image...and TIFF, Thumbview has changeable views, sorting and thumbnail predefined sizes for fast thumbnail size setting. Viewer...use it as an organizer. It also includes image compare. In Compare you can compare images side-by-side....
 
compactslide showeditorfast image viewer
jAlbum

Commercial by JAlbum AB
137 x 10650Kb downloads

Free Vista Files award
...Manage your photos jAlbum has a built in image editing features for basic image re touching and...your album Use flexible templates called "skins" to create customized albums in HTML, Flash or any other...
 
web slideshowweb photo albumphoto gallerythumbnail generatorimage editingweb photo indexjava slideshowjava web album generator
...CoolCap is a MDI Picture viewer using a thumbnail gallery to browse for images. CoolCap provides basic...editing functions alternatively it allows to edit your image in MS Paint. CoolCap provides multiple ways to...the shoot at same postion. By converting those images into high color icons you can archive the...
 
capture screenmdi picture viewericon converter
PaintStar

Freeware by Zhenzhou Wang
88 x 2640Kb downloads

...Transformation tools including rotate,scale,shear,perspective,flip,and wrap. Auto antialias supported. Image Morphing supported. With this technique, you can create...sequence of intermediate frames that seamlessly transform one image to another and generate output in a form...of gif animation or image file sequence. Gradient Fill tools include linear,radial,square,conical(symmetric),conical(asymmetric) and...which outlines the area to be captured.
 
freewaremorphlayerpathscreen captureimage editor
CDH Image Explorer Pro

Shareware by CDH Productions
30 x 21002Kb downloads

...The most complete, all-in-one image and video solution currently available. Allows for fast...viewing, editing, and management of all your image and video formats! Read and write support is...provided for over 70 formats! Over 100 advanced image manipulation and processing features are present. All the...etc.). Advanced features include: batch format conversion, advanced thumbnailing and thumbnail browser, GIF animation creation, GIF to...
 
textprintzoomtwainshapeconverterrotatemirrorbatchclipartthumbnailingresizeeditorcropacquirevideooptimizeviewerflipslideshowprocessingphotoscapturegraphicsanimationspecial paint effectsplayer

Demo by fCoder Group
30 x 3218Kb downloads

...is a graphics converter allowing you to convert images to wireless bitmap (wbmp) format from 50 image...time. If you have a huge number of images and need to convert them to wbmp format...converted wbmps. The program will scan subfolders for image files, create report and delete input files -...converts images, it also edits them. The following image editing features are available - margins crop, rotation,...mirror effect.
 
gifthumbnailconverterimagestiffgraphicsformatpcxbatchviewerdigitalfilewmfbmpjpeg
2Tiff

Demo by fCoder Group, Inc.
33 x 4890Kb downloads

Free Vista Files award
...Batch-convert large numbers of images to TIFF format with blazing speed and reliability...use 2TIFF to settle on a single uniform image size and file format, and discover that you...- Use OCR software to convert TIFF format images to text files for later processing 2TIFF is...for those occasions when you have scores of images to convert into TIFF format. With its feature...scan the source folder and all subfolders for image files.
 
imagestiffwmfbmpformatdigitalgifviewerpcxbatchjpeggraphicsthumbnailfileconverter

Demo by fCoder Group
22 x 3219Kb downloads

...is a graphics converter allowing you to convert images to tga format from 50 image file types...time. If you have a huge number of images and need to convert them to .tga format...converted tgas. The program will scan subfolders for image files, create report and delete input files -...converts images, it also edits them. The following image editing features are available - margins crop, rotation,...mirror effect.
 
imagesconverterbmptiffviewerthumbnailjpegpcxgraphicsbatchwmfgiffiledigitalformat

Demo by fCoder Group
28 x 3220Kb downloads

...is a graphics converter allowing you to convert images to png format from 50 image file types...time. If you have a huge number of images and need to convert them to png format...converted pngs. The program will scan subfolders for image files, create report and delete input files -...it is png editor as well. The following image editing features are available - margins crop, rotation,...mirror effect.
 
pcxfileconverterviewerthumbnailwmfgifimagesjpegtiffgraphicsbmpbatchformatdigital

Demo by fCoder Group
26 x 2802Kb downloads

Free Vista Files award
...is a graphics converter allowing you to convert images to jpeg format from 50 image file types...time. If you have a huge number of images and need to convert them to jpeg format...converted jpegs. The program will scan subfolders for image files, create report and delete input files -...is a jpeg editor as well. The following image editing features are available - margins crop, rotation,...mirror effect.
 
graphicsfilethumbnailpcxviewergifimageswmfbmpconvertertiffformatbatchjpegdigital

Demo by fCoder
23 x 2795Kb downloads

Free Vista Files award
...command line graphics converter allowing you to convert images to gif format from 50 image files formats...time. If you have a huge number of images and need to convert them to gif format...converted gifs. The program will scan subfolders for image files, create report and delete input files -...converts images, it also edits them. The following image editing features are available - margins crop, rotation,...mirror effect.
 
filethumbnailgraphicswmfgifdigitalviewerconverterpcximagesformatbmptiffbatchjpeg

Demo by fCoder Group
23 x 3219Kb downloads

...is a graphics converter allowing you to convert images to gif format from 50 image file types...time. If you have a huge number of images and need to convert them to bmp format...converted bitmaps. The program will scan subfolders for image files, create report and delete input files -...is a bitmap editor as well. The following image editing features are available - margins crop, rotation,...mirror effect.
 
formatgifbmpdigitaltiffpcxconverterimagesgraphicsbatchthumbnailwmfjpegviewerfile
Free Vista Files award
...and easiest way to take screen captures as imagesfrom any part of Windows screen. Combines the power...a first-class screen capture application with an advanced image editing utility - wrapped into one easy-to-use tool!...It`s perfect for capturing images that you want to include in your Help...fit your needs. Assign your own keyboard shortcuts, create instant toolbars, and even control HyperSnap with voice...
 
game captureimage conversionimage capturebutton captureimage editscreen capturescreenshotprint screen