1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...Arpoon Checksum compute checksums of files. A checksum (message digest, hash...files or to follow changes on your documents. Computed checksums: MD5, CRC32, Adler, SHA1, MD4, MD2, RIPE...
 
ripe 160crc32identificationsha256md2md4checksumfingerprintadlermessage-digestfilecomputemd5sha1authentication
Faogen

Shareware by rusted dreams
13 x 855Kb downloads

...Occlusion Generator. Use your video card GPU to compute ambient occlusion really fast. Support both texture and...floating-point render targets and OpenGL Shading Language to compute ambient occlusion data. This process is much faster...
 
graphicsgpuopenglambient occlusionshader
Visual Probability

Shareware by GraphNow
3 x 1860Kb downloads

...Use Visual Probability to compute and graph probability density function values, cumulative distribution...of ten more distributions. Use Visual Probability to compute and graph probability density function values, cumulative distribution...of ten more distributions. Use Visual Probability to compute and graph probability density function values, cumulative distribution...of ten more distributions.
 
probability analysisprobability density function
Fornux Calculator Student Edition

Shareware by Fornux Technologies
19 x 2282Kb downloads

...degree/radian/grad angle, sexagesimal and hexadecimal/decimal/octal/bina ry number to compute any scientific, logical, vectorial and statistical operations including...
 
graphermetriclinearscatter plotmathematicsalgebralogarithmicsoftwareplottercalculatorgraphicsexponentialgraphingtrigonometricmathematicalhistogramplottingstatisticsregressionscientificfunction
Cut 1D X

Shareware by Optimal Programs
12 x 351Kb downloads

...much as the height of the pieces. Automatically compute the number of maximal repetitions for the current...layout. Compute the cutting order which is very important if...Very fast algorithm (Solutions are obtained in seconds). Compute the waste for the current piece. Independent measurement...
 
linearpvcdebitareone dimensionbaractivexprofilwoodcomponentramecadsteeltubesautomationteavacutting optimizationanglespipesoptimal
File Hash Generator

Shareware by BinaryMark
1 x 5393Kb downloads

...Compute and save MD5, SHA1, SHA2, RIPEMD hashes and CRC16/32 checksums for multiple files! Calculate hashes and checksums for the whole file or just specified bytes. Insert hashes into...
 
bytesfilescrc32batchripegeneratechecksumsha2bulkmd5multiplecrc16hashmasscomputesha1crc64content
CRC

Freeware by Psylon
25 x 520Kb downloads

...a CD/Hard disk is readable. For that •I compute the CRC on a tree •I check it...
 
freeware
...Handicap Indexes. It can also be used to compute scoring averages, statistics, leagues handicaps and custom handicaps...
 
golf equipmentgolf shoponline golfgolf shoes
Colcod

Freeware by Emdem Technologies
26 x 229Kb downloads

...and tolerance displays the color codings. Option to compute the resulting value of a series or parallel...
 
e12capacitorcodingresistordecodecolor codeelectronics
Forex Calculator 4.01

Freeware by Dave Parker
12 x 1337Kb downloads

...previous day). The service can help you to compute different parameters like margin requirements, pip value, spread...
 
risk calculatorarbitrage calculatorforex money calculatorforex profit calculatorforex margin calculatortrade calculatorrate calculatorpip calculatorforex calculatorsexchange calculatorforex mentor pip calculator
World Cup 2006 Tournament Calendar

Freeware by Excely.com
19 x 96Kb downloads

...unique opportunity to make informed predictions and quickly compute the game outcome that can bring your team...
 
matchfifagermanycalendarscheduleworldexcel2006cup
Febooti fileTweak Hash & CRC

Freeware by Febooti Software
15 x 851Kb downloads

...CRC is a freeware hash / CRC calculator. Compute hash fingerprint / CRC checksum from any provided...
 
crc32hash valuechecksummd5sha-1
WinDigest

Freeware by Unisoft
3 x 279Kb downloads

...Tool is a public domain free tool to compute check sum values of files by using the...
 
sha-1md5windigestwindows digest
...as you select the text. CAD Closure will compute area and check curves to see if they...
 
dxflegal descriptionsurveyorautodeskcadclosureland surveyingtangentialdwgmappingdgnautocadsoftwarecivil engineeringdraftinggeometic closureacadcogogis
Calculator by Less-Mess

Shareware by Less-Mess.com LLC
8 x 4673Kb downloads

...Full equation and function capabilities, and after you compute them the answer in the tape is underligned....
 
filesproof tapeprintcpacalculatormathematicssubtotalcomputefunctionsinsertequations
Anywhere PE Viewer

Freeware by ucware.com
25 x 19046Kb downloads

Free Vista Files award
...of resources (RT_ICO, RT_STRING, AVI) into files and compute the PE checksum. Anywhere PE Viewer is a...
 
iconviewerdllchecksumexecutablebitmapjavaimportresourcewindowsexportextract
optName

Shareware by optName.com
5 x 226Kb downloads

...are. You will also have the ability to compute and interpret the "number of the name", which...
 
girlforenamedictionarymeaningpersonaloriginchildlexiconboynamingprenamenumerologyenglishglossarybabyhistoryvocabulary
...JSummer is a platformindependent, open source tool to compute and check MD5, MD4, MD2, SHA-160, SHA-256, SHA-384,...
 
checksummessage digestwhirlpooljavamd2ripemd128hashsumklaus zerwessha-256md5sumripemd160zero-sysnetsha-512sha-384havalswtsha-160md4sha1sumjsummertiger
...Handicap Indexes. It can also be used to compute scoring averages, statistics, leagues handicaps and custom handicaps...simplicity make it easy to learn even for computer novices. Whether you are maintaining USGA Handicap Indexes...
 
excelgolfersstatisticsleaguespreadsheetsportshandicapping
VAR Grade

Shareware by VARed Software
11 x 4202Kb downloads

...as T-scores, and attendance can be used to compute grades. Student trends can be computed and plotted,...
 
gradinggradesplotstatisticsattendancegradebook