1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Free-Web-Buttons.com

Freeware by Free-Web-Buttons.com
17 x 10784Kb downloads

...will be no necessity to edit your html code to insert a completed button-menu. Just point out...
 
free web buttonsiphonecss rollover buttonswin7menus
Developer Tool Marketplace News Screensaver

Freeware by DevDirect
71 x 674Kb downloads

Free Vista Files award
...software developers that use custom controls, software components, code generators and other productivity tools to deliver their...lists can help to reduce delivery times, improve quality and cut costs. www.devdirect.com is dedicated to mapping...
 
cbdclassutilitycbuilderdotnetvbnetbeansaddinaspnetreusecnetdevelopmentclxvisual basicaddonactivexcodecomponentcomponettoolvisual studiodeveloperobject
Fingerprint SDK

Trial by Griaule Technology
244 x 16598Kb downloads

Free Vista Files award
...support for dozens of programming languages, richness of code samples, and its thorough documentation, you`ll start developing...and DLL components are available to use. Sample codes provided; * Support for internet Java applets; *...International quality assurance: we were successfully tested among the world`s...
 
software componentbiometricsmicrosoft fingerprint readerjavadelphicrossmatchfingerprint recognitionlibrarysdkuareusoftware development kittesctech bio-isecugen hamsterappletdigital persona
Software Brat Clipboard Utility

Freeware by Software Brat Inc.
69 x 3386Kb downloads

...picture entries by calculating the unique MD5 hash code of each clipboard item. Because pictures can occupy...
 
multipleclipboard utility
Image Eye

Freeware by FMJ-Software
74 x 727Kb downloads

Free Vista Files award
...32-bit floating point / color component). - High quality dithering for superior display of high bit-depth images....exploitation through extensive multi-core support. - Hand tuned code optimizations for critical code paths. - High quality...
 
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
ActiveWidgets

Demo by ActiveWidgets SARL
25 x 702Kb downloads

...online documentation, developer support forum and hundreds of code samples to allow easy integration of ActiveWidgets components...
 
aspnetphpjsondhtmlgridajax tableajax griddatagridxmlcsvlibraryjavascriptgrid componentcontrolgrid controldhtml gridjspjavascript gridgridviewcomponentstoolkit
...deployment. The UML modeling software helps you build quality applications faster, better and at lower cost. You...all types of class diagrams, reverse code, generate code from diagrams and generate documentation. The UML CASE...CORBA IDL, Python +Code Generation - model/diagram to code +Use Case Details Editor - All-in-one environment for...specification and use case descriptions +EJB diagram and code generation +DFD +ORM support - generate Java...
 
analysissoftwaremacdesignjavaoodmodelsreverse engineeringmodelling toolsrational rosecode generationpluginsuse casesobject orientedvisual paradigmclass diagramsuml toolslinuxuml diagramsadd-ins
...deployment. This UML CASE tool helps you build quality applications faster, better and cheaper. You can draw...of UML diagrams in WebSphere, reverse engineer Java code to class diagrams, generate Java code and generate...descriptions +EJB Diagram - Visualize EJB systems +EJB Code Generation +ORM support - generate Java objects from...existing DBMS to ERD (Enhanced) +Reverse engineering - code to model, code to diagram +Reverse engineering Java,...
 
javadesignobject orientedvisualuml toolrational roseibmlinuxuml diagrammodeling toolwebspheremaccode generationpluginreverse engineeringmodelersoftwareadd-inclass diagramuse caseoodanalysis
...deployment. This UML CASE tool helps you build quality applications faster, better and cheaper. You can draw...of UML diagrams in NetBeans, reverse engineer Java code to class diagrams, generate Java code and generate...specification and use case descriptions +EJB diagram and code generation +ORM support - generate Java objects from...+Database generation and reverse engineering +Reverse engineering - code to model, code to diagram +Reverse...
 
object orientedmodeleruml diagrammodeling toolpluginjavause casecode generationsoftwaredesignclass diagramanalysismacrational roseadd-inreverse engineeringvisualuml toollinuxnetbeansood
...deployment. The UML modeling software helps you build quality applications faster, better and at lower cost. You...all types of class diagrams, reverse code, generate code from diagrams and generate documentation. The UML CASE...CORBA IDL, Python +Code Generation - model/diagram to code +Use Case Details Editor - All-in-one environment for...specification and use case descriptions +EJB diagram and code generation +DFD +ORM support - generate Java...
 
add-insmacpluginsobject orienteduml toolsreverse engineeringmodelsoodcaserational rosedesignuml diagramsvisual paradigmmodelling toolsuse caseslinuxclass diagramsjavasoftwarecode generationanalysis
...deployment. This UML CASE tool helps you build quality applications faster, better and cheaper. You can draw...UML diagrams in Sun ONE, reverse engineer Java code to class diagrams, generate Java code and generate...descriptions +EJB Diagram - Visualize EJB systems +EJB Code Generation +ORM support - generate Java objects from...existing DBMS to ERD (Enhanced) +Reverse engineering - code to model, code to diagram +Reverse engineering Java,...
 
softwarereverse engineeringoodmodelermodeling toollinuxmacobject orienteddesignjavarational rosevisualuml diagramuse caseadd-inclass diagramanalysiscode generationsun oneuml toolplugin
Vivid Report Free for Delphi 5

Freeware by MBLabSoft
23 x 1964Kb downloads

...any complexity. Vivid Report provides perfect guaranteed printing quality and excellent productivity of designing. Version 2.0 is...The print of twenty types of the bar codes (EAN 8, EAN 13, UPC A, 25 Interleaved,...possible WYSIWYG and multiple data using. The source code of Vivid Report is included....
 
vivid reportdelphibar codesvisual componentsbuilderdeveloperlibrariesdesignvclprint
Vivid Report Free for Delphi 6

Freeware by MBLabSoft
35 x 2234Kb downloads

...any complexity. Vivid Report provides perfect guaranteed printing quality and excellent productivity of designing. Version 2.0 is...The print of twenty types of the bar codes (EAN 8, EAN 13, UPC A, 25 Interleaved,...possible WYSIWYG and multiple data using. The source code of Vivid Report is included....
 
developervisual componentsdesignlibrariesbar codesdelphivclbuilderprintvivid report
Vivid Report  Free for C++ Builder 6

Freeware by MBLabSoft
39 x 1995Kb downloads

...any complexity. Vivid Report provides perfect guaranteed printing quality and excellent productivity of designing. Version 2.0 is...The print of twenty types of the bar codes (EAN 8, EAN 13, UPC A, 25 Interleaved,...possible WYSIWYG and multiple data using. The source code of Vivid Report is included....
 
librariesvivid reportvisual componentsbuildervclprintdelphideveloperdesignbar codes
Vivid Report Free for C++ Builder 5

Freeware by MBLabSoft
20 x 1928Kb downloads

...any complexity. Vivid Report provides perfect guaranteed printing quality and excellent productivity of designing. Version 2.0 is...The print of twenty types of the bar codes (EAN 8, EAN 13, UPC A, 25 Interleaved,...possible WYSIWYG and multiple data using. The source code of Vivid Report is included....
 
visual componentsprintbuildervclbar codeslibrariesdelphivivid reportdeveloperdesign
...Random Numbers allows you to quickly retrieve high quality random data for use in your own applications....Sample applications and code are included for Visual Basic / VBA, Visual...
 
pseudorandom number generatorpseudorandom numbersmonte carlo
I-Cipher AP

Shareware by AMBITWARE
24 x 4927Kb downloads

...or theft. Only person with a correct encryption code can decrypt images back to their intelligible form....
 
securityencryption toolsdecryptionprivacycipherimage encryptiondata encryptionambitware
XP Web Buttons

Shareware by XP-Web-Buttons.com
26 x 2757Kb downloads

Free Vista Files award
...It generates all button images, Javascript and HTML code on the fly, so you don`t need any...
 
web buttonsweb menus
PDF417-ActiveX

Shareware by RKD Software
31 x 978Kb downloads

...PDF417 Barcode ActiveX Control. PDF417, or Portable Data File 417,...is a two-dimensional stacked bar code symbology capable of encoding over a kilobyte of...This is important for applications where a bar code must be more than merely an identifier such...not accessible when and where the item`s bar code is read. Because a PDF417 symbol can store...all the features necessary to easily add professional quality barcodes to any Windows application...
 
excelofficeocxactivexcodeprintingdelphiwordiispdf417 barcodecontrolsoftwaresteuerelement
DataMatrix ActiveX

Shareware by RKD Software
32 x 971Kb downloads

...DataMatrix ActiveX lets anyone add professional-quality 2D DataMatrix barcodes to any Windows application such as Visual Basic,...Excel, Access, and others. DataMatrix, the public domain code from RVSI Acuity CiMatrix, is a 2D matrix...and accurate recognition even if 60% of a barcode is damaged. The DataMatrix symbol can store between...the inch. DataMatrix ActiveX allows you to add barcodes to database reporting and labeling, product packaging, document..
 
upc-aactivexcode128ocxcode93iisean5steuerelementdelphiean13officeprintingean128wordean8controlsoftwareinternetupcecode39datamatrix barcodeupc-einterleavedupcaexcelean2codabarmsi