1 2 3 4 5 6 7 8 9 10 11 12

Sort by : ReleasedNameDownloadsAddedRatingRelevance
AES Free

Freeware by Safe Soft Corporation
130 x 515Kb downloads

...AES Free is the program that creates self-extracting encrypted files for Windows. Self-extracting files are executable programs (EXEs) that contain a AES-file and the software necessary to...
 
passwordcodecompressdocumentssourceaesencryption systemcryptographic algorithmsshredderprotectingsecuritysoftwaresafetystream cipherfoldersfilesprograms
ABC CHAOS

Freeware by Safe Soft Corporation
122 x 439Kb downloads

...directory structures. For this it uses strong encryption, encryption acknowledged worldwide to be un-breakable....
 
securitytoolsfilesfolderssoftwarechaospasswordshreddersourceprogramsblowfishprotectingcompressrandomsafetydocumentsencryption systemnumbercryptographic algorithmsgeneratorcode
...CHAOS Generator is an application designed to generate passwords of any length and character content. CHAOS Generator will create alphabetic, numeric, alphanumeric or all keyboard characters passwords...
 
securitynumberchaossoftwaredocumentsencryption systemprogramsgeneratorprotectingcryptographic algorithmssourcerandomfilespasswordtoolssafetyfolderscode
CHAOS Shredder

Freeware by Safe Soft Corporation
342 x 195Kb downloads

...Windows does not physically remove deleted files from your hard disk. Emptying your Recycle Bin does NOT protect you at all. Your sensitive files can be recovered, even after you...
 
generatorstream ciphercompressnumbercryptographic algorithmsencryption systemsafetycoderandomchaosfolderssoftwarefilestoolspasswordprogramssecuritysourcedocumentsshredderprotecting
najitool GUI

Freeware by NECDET COKYAZICI
80 x 377Kb downloads

...functions like bin2c which makes a compileable source code file out of any file, like picture files...to 9999 - HTML pages with every possible Unicode letter/symbol - Preprogrammed .BMP pictures, nice for wallpaper...two secure file deletion functions - two file encryption functions And a lot more, enjoy!...
 
najitoolconvertencryptfreegeneratefilternajigui
Developer Tool Marketplace News Screensaver

Freeware by DevDirect
58 x 674Kb downloads

Free Vista Files award
...software developers that use custom controls, software components, code generators and other productivity tools to deliver their...controls, charting and graphing components, email components, data encryption components, user interface suites and many more! Dev...
 
cbdclassutilitycbuilderdotnetvbnetbeansaddinaspnetreusecnetdevelopmentclxvisual basicaddonactivexcodecomponentcomponettoolvisual studiodeveloperobject
...transfered data are scrambled using on-the-fly 128-bit AES encryption with random session keys, without need of SSL...security is provided in two different modes: symmetric encryption with shared secret key and asymmetric encryption with...
 
securenetworkingencryptionprivate
...complicated Perl, PHP, ASP and Web DB, profound encryption algorithms, do not need to write a piece...
 
right clickjavascriptweb siteprotect images

Freeware by ComponentSpot
30 x 1347Kb downloads

...allows even less experienced programmers to add strong encryption and authentication services to their programs, security features...their projects more secure. Some of the symmetric encryption (private key) and authentication algorithms that cryptlib supports...· ssh It features various hashed message authentication code algorithms: · HMAC-MD5, HMAC-SHA, HMAC-RIPEMD-160 Finally, asymmetric (public/private...
 
encryption delphiencryption ocxencryption programmingencryption activexaes encryptionactive encryptionencryption componentencrypt visual basicencryption dllencryption library
...utility program that uses the free Diamond 2 Encryption Algorithm. Full source code and documentation of the...and author contact information has been updated. The encryption key may be a passphrase on the command...file. You may use the included encryption/decryption source code in your own products at no charge. This...
 
securitydiamond2dlock2file managementencryptionutilitycryptography
...dsCrypt is AES/Rijndael file encryption software with simple, multi-file, drag-and-drop operations. It features...performance and safety measures. dsCrypt uses an advanced encryption algorithm and offers unique options for enhanced security....to keylogger-infested environments - disclosed implementation and source code - secure use of system resources - verified...
 
privacyaesfilerijndaelencryptionperformancesecurity
Database Manager

Freeware by Inner-Smile.com
29 x 816Kb downloads

...functions are: Table creation (generates table creation source code for BDE engine, Apollo driver, Advantage driver), converts...
 
hipersixclippertableconvertapollocdximportdatabasesntxdbfdecryptmysqladthiper-sixadvantagedatabasemaintainindexfoxprofreewareencryptmsqldelphipackfoxbaseproxmldbaseexport
LabVault Data encryption utility

Freeware by Labtam Inc.
12 x 1163Kb downloads

...computer like e-mails, passwords, Bank account or source code information. Anything can be kept inside LabVault which...
 
security softwarecomputer securitydata encryptiondata protectionfile encryptionfile protectidata securityfile lock
Easy HTML To Any Script Converter

Freeware by easy HTools
18 x 235Kb downloads

...and easy conversion of HTML Files and HTML Code Blocks pasted from Clipboard to any Script (the...
 
html phpencrypt emailhtm2jsfreewarehtml2phphtml javascripthtm2phphtml2js
KeePass Password Safe

Freeware by Dominik Reichl
20 x 1300Kb downloads

...are encrypted using the best and most secure encryption algorithms currently known (AES and Twofish). For more...at its full source and check whether the encryption algorithms are implemented correctly....
 
openmanagersafesecurekeepasspasswordcodedatabasesecurityencryptionkeyfreemasterdisksource
I-Cipher AP

Shareware by AMBITWARE
13 x 4927Kb downloads

...use or theft. Only person with a correct encryption code can decrypt images back to their intelligible...
 
securityencryption toolsdecryptionprivacycipherimage encryptiondata encryptionambitware
Advanced HTML Protector

Shareware by Creabit Ltd.
13 x 1741Kb downloads

...etc. It encrypts your Web Page using six encryption schemes and makes the source code impossible for...Protector can also compress a Web Page before encryption so that the size of the Web Page...
 
businessprotectdownloadssourcesoftwarehtmlwebsitecreabithidewebdesignpageencryptdevelopment
Absolute Database

Shareware by ComponentAce LTD
15 x 34799Kb downloads

Free Vista Files award
...DB is written completely in Delphi, full source code is available. Absolute DB is a great BDE...DB-aware controls; Strong encryption; BLOB compression; Full source code available; Royalty-free; Free for personal use; Ease of...SQL scripts; Parameters in queries; Small size of code added into the application by the database engine...
 
single file databasedatabase delphibde replacementdelphi databasedatabase componentbde alternative
AeroTags TagsLock Pro

Shareware by AeroTags Software
13 x 1045Kb downloads

...content of your web pages and hide source code of your HTML and XML documents? There is...The protection helps you to hide the source code of HTML and keep your intellectual property on...that use JavaScript and ASP (Active Server Pages). Encryption helps you hide the source code of HTML....
 
protectenhancewebdesignwebsiteblockantispamemailcontentextractors
SourceGuardian PHP Encoder

Commercial by SourceGuardian.com
21 x 22425Kb downloads

...your PHP scripts. Main feature list: + Full Bytecode Encryption - protect your files by removing the original...PHP Source Code + Fully encode and deploy for PHP5 (and PHP4) + Choice...Windows/Linux/Mac OS X encoding clients + Command line encoder available now + Encrypt to domain name +...
 
encryptionsecurityphp protectphp encoderobfuscationencrypt phpprotectionscript encodingphp encrypt