1 2 3 4 5 6 7 8 9 ... 34 35 36 37 38 39 40 41 42 43

Sort by : ReleasedNameDownloadsAddedRatingRelevance
ID3 renamer

Freeware by x2develop.com
360 x 87Kb downloads

Free Vista Files award
...you need to rename a large number of files in a directory accordingly to their ID3 description...pretty "smart", as it lets you assembly the filename as you wish and use the variables from...roll-down menu). Do you have loads of MP3 files in a directory and need to write a...make you very cheerful if the amount of files is large. Using ID3 renamer, everything is a...a few mouse clicks. Do you need to clean some portion of the ID3 tag? Use ID3...
 
tagtaggerid3id3 taggeraudio toolfolderbitrateid3 renamertaggingfreedbedit id3 tagscddbid3v2mp3id3v1tag editorbatchfile renamerename mp3id3 tag editorfile renameralbummusic
Advanced Diary

Shareware by CSoftLab
155 x 21023Kb downloads

...to store multiple diaries in a single database file for added convenience. Regardless of the reason for...can also be added to entries along with file attachments and hyperlinks to websites, locally stored files...in the database are also supported. With a clean and easily navigable interface, you can start getting...
 
diary softwarecalendarjournalelectronic journalelectronic diarydigital diarydiary programjournal software
Blog Navigator

Freeware by Stardock Systems
99 x 1093Kb downloads

...cases - Can import OPML and other common files (makes it easy to share settings between various...for enclosures (podcasting). Users can now download any files attached to their RSS feeds. - Menus for...
 
stardockbloggingcommunicationbrowsingrss feedsinternet
Shark Email Extractor

Freeware by Logambo.com
249 x 440Kb downloads

...Shark Email Extractor is designed to search chosen files for email addresses and it automatically extract all...
 
email extractorshark email extractoremail harvestermass mailemail hunterclean mailing listshark genharvest email addressesbulk emailemail grabber
Disk Redactor

Freeware by CEZEO software Ltd.
132 x 381Kb downloads

...you securely erase any old ( deleted ) files and prevent them from being recovered. All your...
 
clear filedisk wipedelete fileclean folderremove fileclear folderclean filefile wipedisk redactor
Privacy Keeper

Freeware by PIMASOFT
164 x 67800Kb downloads

...are stored in your browser and other hidden files on your computer. Privacy Keeper guarantees your privacy...partial privacy protection by allowing some temporary Internet files and cookies to be deleted, but they do...not clean data out of all the hidden files nor do they delete the data securely. Privacy...drive space and speeds up system performance by cleaning out old and unused temporary records. It allows...
 
remove trackskeeperprivacy guarderaserinternet activitypersonal informationerror fixer

Freeware by Backtec Software
107 x 7339Kb downloads

...Change Video Resolution, RGB Color converter, Drives Info, File Inventory, 2 IconViewers, Long File Name Backup and...Restore, Make Shortcut, Move files and folders, MyNotes Lite, MyNotes, Sort Lines Alphabetically,...settings helper, SpellCheck, Auto Connect, Network Auto Connect, Clean Temps, XpConfig, Note Calendar, Cash Calculator, Font Viewer,...
 
checkbookrgblfncolornotesschedulercalendarfreewaremoveareacodes
Image Eye

Freeware by FMJ-Software
75 x 727Kb downloads

Free Vista Files award
...and free - image viewer with a nice clean user interface. Feature high-lights: - The only image...you need for viewing and browsing images. - Clean with no unnecessary menus and toolbars wasting desktop...highly tuned code. - Reads all common image file formats. - Image index feature with very fast...superior display of high bit-depth images. - Asynchronous file I/O allows decompression to start before file read...
 
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
Disk Investigator

Freeware by Kevin Solway
164 x 359Kb downloads

...Undelete previously deleted files. Verify the effectiveness of file and disk wiping programs....
 
recoverforensicsdriverecoveryinvestigatecleandisksearchsecurity
...add-on for people who use LimeWire to download files such as MP3 Music! The features include detection...of fake or corrupt music downloads, file management functions for organizing your files (such as...or moving them to another computer) and a File List Generator to create a searchable database of...your files so you can always track all your files...the list with friends as a reference.
 
download limewire freelimewire 410free limewire
Free Asmw Eraser Pro

Freeware by asmwsoft.com
78 x 1700Kb downloads

...cache, cookies, history, visited URLs, typed URLs, index.dat, Clean Forms Passwords data, temp folders and more. The...or URLs. It supports free plug-ins to extend cleaning features to support popular programs such as ACDSee,...and sanitizing standards, You can then completely overwrite files with random characters making them unrecoverable by undelete...that once deleted with Asmw Eraser Pro, your file data is gone forever and cannot be recovered,...
 
speed tracks eraserclear cookiesboss keycover internet tracksremove internet historysecurityclean
...DeleteMe for Windows removes files that are unchanged for a specified period. It...may be used for regular cleaning of temporary or working folders, log files folders,...network shared folders used for temporary file sharing or other folders that must be cleaned...a regular basis. Main features - safely removes files when they are unmodified for a user specified...period - can track and clean unlimited number of folders - may be used...
 
foldersdeleteeraseworkingremovaltemporaryfilesdeleteme
Softe APE to MP3 Converter

Freeware by Softe.net
15 x 1502Kb downloads

...high-quality encode. Batch converting tons of ape, mp3 files at one time. Convert lossless audio format and...very easy to use, no training required. Highlighting file format with colors in the converter. No ads...or spyware, 100% clean and virus free. http://www.softe.net/audio-con verter/...
 
ape mp3 converterconvert ape mp3
Advanced Disk Cleaner

Freeware by Innovative Solutions
72 x 2664Kb downloads

...programs on your computer create temporary and garbage files and leave them behind on your hard disk....These files build up over time, taking up valuable hard...space and slowing your system down. Advanced Disk Cleaner is a free program which makes it easy...quickly find and wipe away all the garbage files on your computer. It scans your disks quickly...and then displays the garbage files so you can decide which of them you...
 
filestemporary files cleanersystemgarbagesystem cleaner
Easy Erase File Cleaner

Freeware by EasyErase.com
70 x 335Kb downloads

...Easy Erase File Cleaner is a simple file cleaning utility. Easily erase your temporary internet files, temp...an option to perform at startup, Easy Erase File Cleaner also allows you to easily clear your...
 
delete temp filesclean filesfree file cleanererase fileseasy erase file cleanerdelete files
...addition, you can have Free Internet Eraser automatically clean your files at Windows start or shutdown. Free...that once deleted with our Internet Eraser, your file data is gone forever and can not be...
 
internet erasererase internet historyinternet eraser prodelete internet history
SC-DiskInfo Standard Edition

Freeware by Soft-Central
51 x 320Kb downloads

...This program will track down those folders and files that are using most disk space so you...can remove unwanted data and clean up your drive effectively. It displays details, including...number of subdirectories, file count and overall size, as well as a...
 
sizecleanoptimizationremoveusageanalysemanagementfolderdiskchartfiledelete
Npust email list manager

Freeware by NPUST SOFTWARE
55 x 433Kb downloads

...one file. Split large lists into several files. Clean duplicate addresses. Remove addresses based on domain or...list Sort and remove duplicates from user specified files Randomize the email addresses in user specified files...
 
email collectoremail list manageremail creatoremail managementtext editoremail extractormaillist manager
Privacy Mantra

Freeware by Codeode
91 x 1000Kb downloads

...Privacy Mantra keeps your computer clean from online and offline tracks. Most people are...download the latest database of threats. This reliable cleaner will not only protect your privacy but also...
 
cleanerasecacheautoremovediskmachinewashlockindexdatprotectmantraprivacysearchcookiesinternet historythreatcodeodespacejunktracksystemdocumentswebsiteauto completeassistant
Free Music Downloader

Shareware by FreeMusic
324 x 11530Kb downloads

...play list. You can also add local music file to this player. Compatible with all mobile devices...
 
free music downloaddownload free musicdownload mp3free mp3 downloaddownload musicdownload free mp3