1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...receiving, buffer congestion and flow control. There is support for automatic DNS name resolution and SOCKS proxy...
 
securenetworkingencryptionprivate
VZOchat

Freeware by Visicron Systems, Inc.
123 x 2840Kb downloads

...Easy-to-use, small software application for free video communication via the Internet...require special skills to use. Its advanced network support allows connections when both users are behind a...allowing direct connections in many network configurations. The software provides good video quality with full-screen video support...and detailed user information with a photo. The software supports downloadable skins and language packs....
 
video chatvideo messagingvideochatvideo communicationvideo conference
SkyFex Remote Desktop

Freeware by Tomsk, Inc.
88 x 2016Kb downloads

Free Vista Files award
...it. SkyFex is a secure service for remote support solutions and help desks. It works directly in...or Internet Explorer) and does not require additional software installation and configuration. SkyFex is available as a...Remote computer control via mouse and keyboard; - Support of Firefox, Chrome and Internet Explorer (including IE...
 
remote destopdesktop streamingremote accesshelp desk softwareremote assistancedesktop sharingremote supportonline collaborationremote desktop controlremote solutionremote support softwareremote control
SysAid IT Management Software

Freeware by SysAid Technologies
72 x 383336Kb downloads

...SysAid >Help Desk Software is a an IT Help Desk software that...SysAid is powerful and easy-to-use IT Service Management software with all the essentials in one IT software....and monitoring your organizations network (SNMP devices, hardware, software and change history) and raising early warning alerts...(email, SMS). Support your users anywhere around the world, via SysAid...
 
cmdbbenchmarkhelp deskslapatch managementmonitoringknowledgebaseself servicechatreset passwordmdmslmmobile device managementbyoditilremote accessasset managementremote control
Boldchat

Freeware by BoldChat
31 x 8100Kb downloads

...Free live chat software for online sales and support teams. Increase sales, improve customer service, and reduce...costs. Simply install the client and add a chat button to your website to start chatting with...click-to-call visitors to click-to-call and and initiate pro-active chats with visitors. Used by over 11,000 active websites....
 
contactscrmticketlive supportlive chathelp desksoftwareweb logcustomershelpdeskcontact managerweb statssalesemail managementwebmasterweb logsemail managerweb statisticsweb analyticslive help

Freeware by IRCXpro
51 x 6662Kb downloads

...IRCXpro Messenger supports all common IRC client functionality from full color...Panel for quick and convenient access. The client software is designed to run from the System Tray....message, the system tray icon flashes with a chat bubble and a double click will quickly open...Windows Domain integration using NTLM and SSL Encryption support (for both Client to Server and User to...
 
chattalkircdconferenceircxmirc
Boldcenter Operator Client .NET

Freeware by Bravestorm, LLC
18 x 4263Kb downloads

...Free live chat software for online sales and support teams. Increase sales, improve customer service, and reduce...costs. Simply install the client and add a chat button to your website to start chatting with...emails, manage help desk tickets, and initiate pro-active chats with visitors. Used by over 11,000 active websites....
 
crmsoftwareweb statscontact managerlive chathelpdeskhit counterweb logstickethelp deskemail managercustomersemail managementwebmasterweb statisticslive supportsaleslive helpcontacts
Likno eLearning LMS

Commercial by Likno Software
12 x 339Kb downloads

...lessons at multiple conceptual levels called categories. - Support for forum, chat, calendar, personal messages, etc. -...Content Editors with support for pictures, sound, video, flash or java -...& share files - Test Builders - SCORM Support - Projects: Assign projects with deadlines - Multilingual:...Unicode support (full language administration module). - Surveys: Create, share...
 
learning platformlmscourse management systemsoftware elearningweb based trainingscormlearning management systemscoursewarelearning management softwaresoftware e-learning
UltraVNC

Open source by UltraVNC Team
130 x 3300Kb downloads

Free Vista Files award
...remotely ! Your customers don\`t have to pre-install software or execute complex procedures to get remote helpdesk...a simple Web Browser on any Operating system supporting Java™ (Linux, Mac OS...) to an UltraVNC server....
 
freeware
LanToucher Network Chat

Freeware by Vital Sound Laboratory
116 x 1668Kb downloads

Free Vista Files award
...LanToucher Network Chat is small and easy-to-use chat software for your small office or home LAN (Local...Area Network). This easy-to-use LAN chat program with simple, intuitive user interface and a...for your small office LAN and a perfect chat application for your private home network or intranet....LanToucher™ Network Chat software supports the system tray (taskbar notification area) and sound...
 
instant chatintranet chatnetwork chateimchat messengermessenger servicelan chatnet sendwinpopup
Free Vista Files award
...during a Skype call) - Answering machine - Chat auto reply when you are away - Application...
 
productswebsitecommunitymachinesystemsupportanswering machinemessagesmailautomaticchatvoicemailupgradescontactvoipdesignskypemessagingpamelafeaturestextsoftware
MorphVOX Junior

Freeware by Screaming Bee LLC
93 x 1864Kb downloads

Free Vista Files award
...will change the way you play games or chat online. Change your voice to sound like man,...works with all the popular game and online chat programs including Skype, AIM, Yahoo, MSN, GoogleTalk, TeamSpeak,...your voice Integrates easily with online games and chat programs Low bandwidth and CPU usage Built-in Voices...Built-in sound effects Full key, mouse and joystick support for gamers...
 
changingtalkskypevoipgamesfreesoftwaremessengervoice changeronlinechatteamspeak
dotSilver Partner

Freeware by Skalfa eCommerce
31 x 542Kb downloads

...on a bleeding-edge technological base. We delivered the software with the simplest and smoothest yet funny user...shared between hundreds of dotSilver Partner driven sites. Software features:
  • Audio/Video Live Flash Chat and Instant Messenger;...
  •  
    matchmaking website scriptdating softwaredating scriptmatchmaking softwarematchmaking scriptdating website scriptpersonals softwarepersonals scriptpersonals website script
    DC++ MP3 Finder Premium

    Freeware by DCPlus MP3 Finder LLC
    23 x 2055Kb downloads

    ...DC++ MP3 Finder is a FREE software based on the original DC++ open source application....sharing experience to its users. DC++ MP3 Finder supports a list of advanced features as: 1. Has...an alert will be generated 8. Has built-in chat system, so you can freely talk to other...online DC++ users 9. Multilingual support is available and fully configurable via XML files...
     
    fast downloadfile searchp2p networkfile sharingpeer-to-peerdirect connectmp3 searchpeer-2-peer
    Online Backgammon

    Freeware by Play65 Backgammon
    69 x 297Kb downloads

    ...is intuitive and crisp. During gameplay players can chat with each other and use the doubling cube...
     
    play65checkersdicechouetteskill gameinternet backgammonshesh beshboard gametavlagnubggammonvillagesheshbeshbgblitzblotgammonempireonline backgammongammon villagebkgmtabulafibsgammon empiregamingback gammon
    Live Support Chat Tool

    Shareware by Live Support Chat
    32 x 15564Kb downloads

    ...eAssistance Pro is a powerful live support chat tool for online business that aim to convert...because it intends to offer the best live chatting experience with real-time monitoring of website traffic. It’s...with your website using 6 different types of chat codes, i.e. fully-featured chat button code,Chat button code...with image/link for email, Chat button code with custom images, No script chat...
     
    online web chathelp desk softwarewindows live chatlivehelplivesupportlive support chatlive support chat toollive chat software
    TrueCafe. Internet cafe software

    Adware by TrueCafe, Ltd.
    52 x 10887Kb downloads

    Free Vista Files award
    ...Friendly cyber cafe software with a complete set of features for cyber...cafe management: wi-fi billing, thin clients support (NComputing, Windows Terminal Server), tickets, license keys, pre-paid...customers for monochrome and colour printing. Organize a chat between operator and customers. Browse a terminal screenshot,...Make your unique receipt design. Use TrueCafe Client software to lock cyber cafe terminals and display customer...
     
    monitoringinternet cafecyber cafesoftwaresystemreportingmanagementbilling
    VueChat Enterprise Server

    Shareware by VueCam
    22 x 607Kb downloads

    ...home use, you may want to begin with VueChat Home which is the easiest way to start....With VueChat Home you may connect to every available VueChat...Server registered in the VueChat Global Servers list and communicate with people all...the Internet. For corporations and governments we supply VueChat Enterprise as a solution for web-based Customer Service...Live Video and VoIP (Voice over IP) technologies.
     
    serverjmfbusinesswebcam chatvideo chatcommissionlive voiceuservoipclientunixcustomer support softwarecustomer service softwarelinuxgovernmentcorporationsenterprisejavacrmrecordsaffiliaterepresentative
    Free Vista Files award
    ...VirtualCamera is a virtual software camera that can be installed on Windows 98/ME/2000/XP/2003/Vista....it as a real camera. Most popular IM software such as MSN Messenger, Yahoo! Messenger, PalTalk, etc....movies to them, you can use VirtualCamera. VirtualCamera supports most type of media such as pictures(jpg, gif,...videos(wmv, avi, asf, mpeg, rm, rmvb etc.). And support flash file too. You can select a folder...your net friends one by one.
     
    virtual camerawebcamchat instant messengersoft cam
    CyberScrub Privacy Suite tools

    Shareware by newqite.Inc.,
    24 x 3875Kb downloads

    ...to retain Restore Points when wiping free space. Supports IE, Netscape, Mozilla Firefox, Opera. Excellent documentation and...
     
    wipeprotectdiskprivacyonline activitysecuritycleandriveencrypt datainterneteraseerase filesdeletion