1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server...feeds, public folders, contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online document sharing into a rich...provides real-time, two-way synchronization of mail, contacts, tasks, calendar events, notes and journal items between Outlook (2002/2003/2007)...integration with existing directory services.
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Salaat Time

Freeware by Salaat Time
141 x 14351Kb downloads

Free Vista Files award
...have a perpetual side-by-side monthly Hijri / Gregorian calendar which highlights important Islamic dates and moon phases....yearly prayer time views. •Perpetual side-by-side monthly Hijri/Gregorian calendar with full forward/backward navigation. •Important Islamic dates highlighted...and vice-versa. •Export and print monthly prayer time calendars in both Hijri and/or Gregorian formats. •Export prayer...schedule to calendars using the Oulook CSV format.
 
prayer timesmuslimathanhijri calendarathansislamprayer softwareazansqiblah direction
Easy2Sync for Outlook

Freeware by ITSTH
53 x 9250Kb downloads

...Outlook and copy any new or changed e-mails, calendar items, contact, tasks or notes to the other...with normal PST files as well as Exchange server accounts. You can either synchronize your data or...or merge multiple calendar/contact folders into one team calendar / team contact folder. The sync can be...
 
sync outlooknetzwerknetzwerktoolsmicrosoft outlooklannotebooksynchronize outlooksynchronize pstlaptop
Time Watch

Freeware by 7tech Limited
36 x 1620Kb downloads

...the program offers information as for example a calendar with all holidays and special days for Germany,...
 
clientsystemntpsynchronize
A VIP Task Manager Professional Edition

Shareware by VIP Quality Software
38 x 40836Kb downloads

...Task List view - Task Tree view - Calendar view - Resource List view - Task Groups...
 
teamwarenetworkproductivitystaffcollaborationclient serversoftwarehuman resource managementtask managementemployeetrackingpersonnel managementbusiness productivitynotificationschedulingtime managementprojectgroupware
GroupWare

Demo by Alt-N Technologies, Ltd.
16 x 1946Kb downloads

...of Microsoft Outlook using MDaemon as the mail server platform. Outlook users can share Calendar, Tasks, Contacts,...allow you to see items in your Outlook calendar from anywhere, and GroupWare licensing is independent of...
 
mdaemonshare foldersshare tasksshare contactshttpldapimapsmtpgroupwareweb mailpop3email serverexchange alternativeshare calendare-mail
Free Vista Files award
...1/50s accuracy). Adjust the time with atomic time servers either once or regularly at the specified intervals....1st Clock queries several servers to improve reliability and precision of your computer`s...to the atomic time. Use 1st Clock time server to synchronize time in the entire network. Click...the clock once to open 1- or 2-months calendar view. Use it to find the difference between...
 
alarmstime zone clocktime zonessystem clocktclockexworld clockatomic timetray clocktaskbar clockcalendar
LiveProject Free Project Viewer

Freeware by KaDonk, Inc.
70 x 29656Kb downloads

...Project files, shows you tasks lists, Gantt charts, calendar views and everything a project manager or team...
 
liveprojectmppproject collaborationproject serverproject planproject viewerproject managementoffice project serversharepointmicrosoft projectproject schedulekadonk
Free Vista Files award
...you while travelling with your notebook; publish your calendar to a shared folder, synchronize your private calendar...
 
sync tooloutlook synchronizationoutlook add-onnotebook syncoutlook notebookshared foldersoutlook 2010outlook 32-bitshared contactsoutlook 64-bitshared outlookoutlook synchronizershared emailsoutlook sharing
KooMail

Freeware by Koomail Software
21 x 3191Kb downloads

...The best remote function to manipulate messages on server direct. Copy to USB-Disk or any other disk...
 
koomail

Shareware by Skin-clock.com
29 x 2110Kb downloads

...SkinClock. It lets you showing current date and calendar only with the one mouse click, adjust and...
 
atomic clockatomic serverdesktoptrayclocksynchromize timetaskbar clocksynctimeatomic time programatomic time softwaresntp
...PST from OST? In case of Microsoft Exchange server downtime or due to server crash, unintentional user...
 
convert ost pstost files pstost recoveryost pst convertercreate pst from ost
...small and mid-sized businesses by using MDaemon Email Server as the mail messaging server. With Outlook Connector...co-workers, customers, and vendors by sharing Outlook’s email, calendar with free/busy scheduling, address book, distribution lists, tasks,...to mid-sized business budget. Alt-N Technologies’ MDaemon email server provides outstanding groupware and collaboration functionality when paired...
 
tasknotesoutlook connectormail servergroupware softwaremicrosoft outlookcalendarjournalcalendar sharingmdaemoncontact
...easily install cgi or php scripts on any server with just a few mouse clicks! Our mission:...it as easy to install scripts on a server as it is to install software on a...UNIX knowledge to easily install scripts on a server with just a few mouse clicks! Using a...
 
websitewebmasterhtmlbulletincustomerdatabasecommercecookiegameguestbookmanagementaudioweb-sitecalendarbannerclockfilecgiinstallcounterprocessingadschatscriptclassifiedsupportauctioncountdownphpmanipulationboard
MAPILab Share`n`Sync

Shareware by MAPILab Ltd.
18 x 3009Kb downloads

Free Vista Files award
...The product is fully compatible with Microsoft Exchange Server and Microsoft Small Business Server. So if you...to synchronize a shared folder on Microsoft Exchange Server with an ordinary folder on your home PC......
 
sync pstmicrosoft outlookoutlook add-inoutlook shared accessoutlook synchronizationpublic folders
Fast Forms

Shareware by Golabs
26 x 3046Kb downloads

Free Vista Files award
...without you needing any knowledge of HTML or Server Side coding. Key Features - Upload files with...for quick number selection Terms and conditions confirm Calendar feature Mouse over help feature in form Paypal...a form, validating a form both locally and server side, capturing form data, encrypting form data, emailing...
 
phpperlformshtml
...support the saving functionalities, which involves several email servers and Web-enabled email apps. MS Exchange Server, IBM...Apps are the list of some supported email servers and Web-based email apps, respectively. Despite this, you...can easily convert OST files of Exchange server 5.0, 5.5, 2000, 2003, 2007, 2010, and 2013,...
 
ost pstconvert ost pstost pst converter toolconvert ost pst file
MailEnable Enterprise Edition

Demo by MailEnable Pty. Ltd.
20 x 69563Kb downloads

...Console, MailEnable has remote administration capabilities for managing server clusters – provides easy access and the ability...to administer a remote mail server like a local machine. Web Administration is enhanced...MD5, APOP and SMTP authentication, protect your mail server from unauthorised access. Now includes additional security features;...junk mail; Scalability & Optimised Services - Create server clusters and store user configuration data in Microsoft.
 
email serverpop3imapunlimitedweb mailimap4e-mailmailenablehttpmailsmtpmail enable
WinWebMail Server

Shareware by WinWebMail
37 x 8620Kb downloads

...function. 14. Excellent web support. 15. Provides complete calendar and schedule service, making it easier for you...
 
imap4serverantispamwebmails-mimersabbssmtpantivirusssldsspop3mail server
...CARTHAGO Groupware 2005 is a application server for MS Windows platforms to manage email, contacts,...by each user himself. System administrators can change server settings, edit domain and user accounts and view...interface and can be integrated in almost every webserver with ISAPI support. The open database interface allows...
 
calendarisapigroupwarewebmailsmtppop3email