1 2 3 4 5 6 7 8 9 ... 21 22 23 24 25 26 27 28 29 30 31 32 33 34

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...with 17 special categories that allow to clean cache of practically any popular browser, various system and...
 
cleaningclean hard drivefile garbagejunk filesdisk cleanupcleaning the diskunused files
Websiteoutlook V2 PHP Clone Script

Shareware by EziScript
266 x 29314Kb downloads

...Slider Auto Suggest Website Recently Visited Websites New Cache System Visitor can easily Remove there site from...
 
php clonephp clone scriptwebsiteoutlook cloneeziscript
AgataSoft ShutDown Pro

Shareware by AgataSoft
18 x 1233Kb downloads

...This program is a powerful automated tool for shutting down your computer. The program can shut down your computer: At a certain time (for example, at 12:00). In a...
 
automatic shutdowncomputer shutdownwindows shutdownpower downnetwork shutdownremote shutdownvista shutdown
...quick search of SWF files in the webbrowser cache or in a custom folder. SWF graphics can...
 
update swfcompress swfswf exeswf editorexe2swfflash editorswf decompilerdecompress swfedit swfexe swfexplore swfswf2exeupdate swf file
Data Wipe Software

Demo by Unistal Systems Pvt. Ltd.
14 x 2101Kb downloads

...To erase magnetic media, we need to overwrite it many times with alternating patterns in order to expose it to a magnetic field oscillating fast enough that it does the...
 
securediskdatafileeraser
Abexo Defragmenter Pro

Shareware by Abexo
16 x 1887Kb downloads

Free Vista Files award
...Junk files such as Internet Temporary Files, Java cache and Windows temporary files take up often more...
 
pagefileswapfiledefragmenterscandisk
Shred Agent

Shareware by AKS-Labs
17 x 1053Kb downloads

...With the wide use of encryption systems, an attacker wishing to gain access to sensitive data is forced to look elsewhere. One way to attack is to try to recover...
 
hard diskcachewipe fileserasensadisk wipeshred agentsensitive filesshreddercapture deletionsecurehistorycookiebackground wipeunwanted filesdelete
...name and may be registered into Global Assembly Cache (GAC) by means of gacutil. For instance, the...
 
net config managernetwinformscomponentsidmnet configurationnetwebcontrolsnetconfiguration
Abexo Defragmenter Lite

Shareware by Abexo
24 x 1885Kb downloads

Free Vista Files award
...Junk files such as Internet Temporary Files, Java cache and Windows temporary files take up often more...
 
defragmenterswapfileoptimizerpagefilescandisk
SwitchSniffer

Freeware by SoftAhead Inc
227 x 3380Kb downloads

...1. Overview SwitchSniffer is a program that can scan your switched LAN for up hosts and can reroute and collect all packets without the target users` recognition. It can also...
 
arp spoofing detectionsniffer enablerfirewallarp spooferswitchsniffer
Easy Download Manager

Freeware by Onny Felt
1 x 413Kb downloads

...Administrator rights are not required to install, use, and uninstall. Changing the download sequence of the files in the list. Concurrent connections are supported (4 files * 4 segments, up to...
 
download managerresumedownload programeasy download manager
Browser History Cleaner

Freeware by Windsty, Inc.
15 x 904Kb downloads

...detects and cleans browsing history, cookies and internet cache - Easy to use - no special knowledge...
 
remove browser historycrap cleanerdisk cleanerccleanerremove internet historybrowser history cleanerjunk cleanerremove cookiesclean cookies
WebGrid - AJAX Rad / Data Grid

Shareware by WebGrid Software
14 x 5200Kb downloads

...Advantages of using WebGrid ------------------------------ ------ Detects and cache data source structures and enables "plug and play"...
 
web formgrideditgridviewwebgriddata griddatabasedatasourcegrid vieweditabledatagrid
...family (BLOB/CLOB, LVARCHAR etc.) connection pool and SQL cache - comprehensive features destinied to increase performance of...
 
deploymentalternativeeasyaccessinformixborlandmigrationbreakdata-awareadosharewarecomponentsvclthird-partycbuilderbdedbawaredelphiexecutionapiquerydb-aware
ZeroNetHistory

Shareware by FBM Software
11 x 6464Kb downloads

...ZeroNetHistory 2005 is the ultimate defense against identity theft – its superior scan-and-clean engine and multiple functions completely protect you from snoops and spies. This free 15-day trial...
 
online protectionhistory eraserdisk cleaneronline privacyfbm softwarezeronethistorysecuritycache cleaner
AidAim CryptoPressStream

Shareware by AidAim Software LLC
10 x 1062Kb downloads

...CryptoPressStream is a streaming compression and encryption library. It provides transparent access to compressed or encrypted data stored in the stream object. All stream objects are 100% compatible with TStream...
 
dataeasylibraryutilitystreamingcomponentsdelphiencryptionstrongcompressionkylixcbuildervcltools
HSLAB Prefetch Manager

Shareware by Handy Software Lab
6 x 2827Kb downloads

...brings much of this data into the system cache with efficient asynchronous disk I/Os that minimize seeks....
 
system tweakingmemory tweakingsystem optimizesystem monitor
Abexo Defragmenter Pro Plus

Shareware by Abexo
12 x 1852Kb downloads

Free Vista Files award
...Junk files such as Internet Temporary Files, Java cache and Windows temporary files take up often more...
 
optimizerpagefilescandiskdefragmenterswapfilecleanup
Abexo Defragmenter Lite Plus

Shareware by Abexo
22 x 1890Kb downloads

Free Vista Files award
...Junk files such as Internet Temporary Files, Java cache and Windows temporary files take up often more...
 
defragmenterswapfilediskpagefilescandiskoptimizercleanup
Veqa Image Effects

Commercial by Veqa
19 x 191Kb downloads

...ImageMagick, MagickWand. Also provides interface, login protection, caching, cache gallery, file saving, class functions, reformatting, user documentation,...
 
phpbrightnessflipmagickwandpicturesharpenveqagrayscalecolorizerotatebitmapbmpinvertgraphicpngimagemagickeffectsjpgcontrastblurgifimgjpeg