1 2 3 4 5 6 7 8 9 ... 51 52 53 54 55 56 57 58 59 60

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging (XMPP) with searchable SQL based archive, web collaboration client...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...a matching message it can add the sender`s address to a list along with a date and...a label indicating why the email was added for auditing purposes. You can optionally...message for deletion after processing, and leave unmatched email in your mailbox to check personally. As part...Mach5 Mailer suite, PopMonger can reply to an email with text from a file, or redirect the...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
SMSCOUNTRY SMS Mail Box

Freeware by SMSCOUNTRY
395 x 2744Kb downloads

...2000, 2002, 2003 versions. Features: 1. Use existing address book contacts from Microsoft® Outlook®. 2. Simultaneously broadcast...
 
email smsmobilesms toolsbulk smssms softwaresms from outlookfree sms
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...service from flooding or directory harvest attacks. Recipient addresses can be checked while a message is submitted,...
 
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
Advanced SMTP Server

Shareware by IM-Soft
590 x 14208Kb downloads

Free Vista Files award
...server program for Windows that lets you send email messages directly from your computer to recipient mailboxes....security an privacy. Advanced SMTP Server supports all email programs like Outlook Express, Outlook, Eudora, etc. The...SMTP Server is able to send thousands of emails per minute with a regular DSL Internet connection....
 
smtpmailfreemailingbookemailmassaddressmailere-mailbulkremailerbomber
...backup, archive, search, print, password protect, hear and email your notes easily and fast. NoteIT was designed...any Apple iPod device and with most windows email clients, so you can email your notes without...colorful skins that are available for free. Free email and phone support are also available....
 
free softwarefreewareipodpimsresearchnote takerfree skinsarchiveaddress booknoteitorganizercalculatorreadernotestext-to-speechapple
DNS4Me

Freeware by RhinoSoft.com
180 x 2715Kb downloads

Free Vista Files award
...can benefit from DNS4Me. This includes FTP servers, email servers, daemons for today`s popular computer games, NetMeeting,...with all other RhinoSoft.com products, DNS4Me includes free email support and a year of free updates! Why...
 
domainddnsdynamic dnsaddressstatic
Subscribe Emails

Freeware by IM-Soft
73 x 609Kb downloads

Free Vista Files award
...Subscribe Emails helps you organize subscription to email mailing lists on Internet websites. It lets you...check POP3 email mailboxes for subscribe or unsubscribe email requests, download email messages with the requests to...your computer, get email addresses and sender names from them and create text...although Bulk E-Mailer has a built-in file and email subscribe and unsubscribe feature, Subscribe Emails gives you...
 
mailingmassemailaddresse-mailfreemailerbomberremailerbulksmtpbook
Free SMTP Server

Freeware by IM-Soft
305 x 619Kb downloads

Free Vista Files award
...server program for Windows that lets you send email messages directly from your computer. It`s very simple...security and privacy. Free SMTP Server supports all email programs like Outlook Express and Eudora, but best...optimized to work with Outlook Express. The email program you already use for sending and receiving...
 
bombersmtpfreemailerbookemailbulkaddressremailermasse-mailmailing
1st Email Searcher

Freeware by IM-Soft
84 x 1503Kb downloads

Free Vista Files award
...1st Email Searcher helps you to search for email addresses in files and folders located on a...PC or on the Internet, and place emails to text files. The program lets you find...all email addresses you have on your PC, grab only those...list files, which can be used by any email program or mass mailer. Just imagine, how it...find that it is almost impossible to grab emails from some file formats because you are just...
 
bombermailinge-mailsmtpmaileremailremailerfreeaddressbookmassbulk
Alien IP

Shareware by ArmCode
89 x 16931Kb downloads

...map. It supplies detailed information about remote domains, email senders and web site visitors. Alien IP has...the user just pastes the name or IP address into a drop-down box on the tool bar...address; - Resolve domain names, IP ranges and address lists from files; - Translate IP address into...
 
searchwebgeolookuphostpositionaddressresolve
Shark Email Extractor

Freeware by Logambo.com
249 x 440Kb downloads

...Shark Email Extractor is designed to search chosen files for...email addresses and it automatically extract all e-mail addresses from those file(s).You can search your entire system...any other source and extract all of the email addresses. Shark Mail Extractor Do not extract email...addresses form websites, if you want to extracting email address from a website you can use our...
 
email extractorshark email extractoremail harvestermass mailemail hunterclean mailing listshark genharvest email addressesbulk emailemail grabber
BREAKTRU MyPhone Book Dialer

Freeware by Breaktru Software
154 x 14604Kb downloads

Free Vista Files award
...phone numbers, cell phone numbers, addresses, company name, email addresses and web page url`s. If you have...to a web page of your contact`s url address with a click of a button. The best...
 
freewarepersonalstore numbersmanagerbookcontactemailphonebusinessdialerorganizer
SpamAware

Freeware by JAM Software GmbH
58 x 14619Kb downloads

Free Vista Files award
...Everyone owning an email address knows these annoying mails you receive. The number...
 
filterspamassassinoutlook expresse-mailspamawareantivirusmore spamplugin
Pivo Email Validator Component

Freeware by Pivo Corporation
111 x 232Kb downloads

...Having problems with the email addresses in your mailing list?Are you tired of getting...bounce backs every time you perform a mailing? Email Validator will solve your email validation problems. Email...framework to run. It is used to validate email addresses at different levels. Email Validator does not...server component that can only be accessed programmatically. Email Validator can be used on signup forms or...
 
asp componentserver componentasp net componentemail validator
Pivo pop3 Component

Freeware by Pivo Corporation
92 x 232Kb downloads

...ASP.NET or other COM environment applications to retrieve email from mail server based on POP3 protocol. Pivo...It also provides advanced features such as retrieve emails in background, capability of unlimited queued request. POP3...
 
email addressasp componentemail parserserver componentpop3asp net component
Pivo InI Component

Freeware by Pivo Corporation
62 x 232Kb downloads

...INI component reads and writes Windows style INI files. It provides a comprehensive set of functions making INI files a powerful way to store application settings. There are three common...
 
asp componentpop3server componentasp net componentemail addressemail parser
Pivo Ping Component

Freeware by Pivo Corporation
70 x 232Kb downloads

...Pivo.Ping allows you to effortless enable your applications to send Internet Control Message Protocol (Ping/ICMP) packets in .NET. Programmatically ping a remote server, host, route, or any network...
 
net componentasp componentemail addressserver componentpingpop3email parserasp net component
Pivo SMTP Component

Freeware by Pivo Corporation
101 x 810Kb downloads

...applications or web pages to create and send email messages over SMTP protocol just in a few...in the HTML format. Smtp Component can send email to any email address with or without smtp...server as parameter. Email can contain any number of attachments, unlimited recipients,...cc`s and bcc`s. Send Email directly from you web page via applications/browsers....
 
server componentasp componentasp net componentemail parsersmtpemail addresspop3ping
V-Mailer

Freeware by Virdi Software
65 x 200Kb downloads

...V-Mailer is 32-bit command-line and batch mailer and supports SMTP authentication. It is a console application, which means that it can only be run from the DOS...
 
consolebatchemailsmtp authentication32-bit command-line mailer