1 2 3 4 5 6 7 8 9 ... 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Digital PhoneBook

Shareware by Techra Software
11 x 2454Kb downloads

...A very simple, fast, friendly contact management phone book software with printing ability, phone dialer integration, backup/restore features, moving/copying contact cards. Easy to understand screen layout. Perfect for...
 
phone numbersdatabasepimsales leacall centerlead management softwarecontact managementphonebookphone listpersonal information managerbulk dialercontact managerwar dialerlead tracking systemphone bookdatabases
OGG Video Converter

Shareware by Ogg-converter.net
2 x 11021Kb downloads

...Video Converter supports batch conversion. You could convert bulk of video and audio files to another format...
 
ogg theorawmv ogvmp4 ogvmp4 oggavi oggvideo oggogg converteravi ogvwmv oggogg video converter
...If you are having lots of pdf documents (directory/subdirectory) locked with owner password and you are unable to edit, print or copy them, try pdf restrictions removal application which...
 
contentsoftwaredecryptdecryptionsecurityunrestrictcommentcombinesignprintsplitrc4encryptionuseraesrestrictionspasswordprotectionpdfbatchaddunlockcopyeditownerfillremoverremovalbulk
Handy File Tool

Freeware by Heatsoft Corporation
17 x 1817Kb downloads

Free Vista Files award
...quick work of file searching, text replacement, and bulk renaming across a range of file formats and...
 
replaceufuheatsoftchange attributesfindcreatebatchtextfreewarefoldersdeletebatch replacereplacerhtml-utilityadcsrenamecopyhtml-editorbasketreplace toolupperconvertfilescaselower casehccsearchreplsoftfile managerusfut
...PDF Split and Merge Pro: Split PDF files into multiple documents, merge multiple documents to create single document, burst documents, add pdf pages, replace pages, append pages, add image and...
 
combinesplitgifrearrangepdfbulkbreakjpgaddburstresetappendfilesbmpreorderpngconvertconverterimagemergerbatchconcatenatesplittersoftwarejoincuttiffdocument
VSDC Free Video Converter

Freeware by Flash-Integro LLC
1 x 18487Kb downloads

...to create a video for multiple media-players and bulk conversion capabilities, Free Video Converter is definitely one...
 
convert video for freevideo converterhow convert videofree video converterfree download video converter
DBSync for Firebird and MySQL

Shareware by DMSoft Technologies
2 x 18024Kb downloads

...too. DBSync for Firebird and MySQL provides the bulk of functional capabilities such as interactive (GUI) mode/command...
 
Firebird to mysql mysql to Firebird Firebird to InterBase Interbase to Firebird sql and Firebird sql to InterBase sql to mysql mysql and Firbird database sql database conversion Firebird dbs synchronization InterBase database conversion
Smart Quote Organizer

Shareware by Bruno Cancellieri
4 x 5941Kb downloads

...languages can be configured) - Import management (including bulk import and sequence randomization) - Export management -...
 
aphorismsquotesorganizerquotationswisdomaphorisms and quotationsquote organizer
...to the database, also an ideal solution for bulk SMS messaging. Power users will appreciate the C#...
 
wctphttpsqlsmppucpmodemgsmtappageremailclickatellsmssnpppagingvisual basic
...is fast and accurate DB converter tool converts bulk database record or a particular database table from...
 
synchronizekeyutilitytransfersoftwaretransformintegritydatabasemultibyteservertableapplicationrowsmigrationtoolindexunicodenullcolumnsaccesstypeconvertattributemysqlprimaryconstraint
...AWinware Pdf Split Merge Professional edition V1.0.1.3 build 1.3 is advance application for joining multiple pdf files into one and for splitting pdf into multiple documents,...
 
createcombineburstreorderimagesplitterconverterpasswordbulkmergelargeconcatenatecombinerprependtoolpdfprotectedsecuredocumentjoinersoftwarepdf into multiple filesaddappend
...What is FitBook? FitBook is mark of a book deal with sport sphere and fitness. FitBook Line is electronic book version, application that runs browser without installation into the operating...
 
freeware
...locations) to valid characters while importing them in bulk to a SharePoint document or picture library. Schedules...
 
sharepoint migration toolfile share migrationfile migration softwaresharepoint document libraryfile server migration toolsharepoint document migrationsharepoint metadatasharepoint picture librarysharepoint file migration
ETKit Chameleon

Shareware by BrandsPatch LLC
4 x 3871Kb downloads

...easily accomplished. Name Control - want to make bulk changes to file names, file extensions? Would you...
 
file backupfile concatenatorhexadecimal editorfile comparatorfile splitterfile splicerversion backupdirectory watcher
Convert MS Access Db to MySQL

Shareware by iPod restore
3 x 1413Kb downloads

...PCs. Advanced database transformation software can easily translate bulk amount of table records from Microsoft Access database...
 
indexconversionconsistencyutilitytransfermysqlmultibyteintegrityfileaccessconvertermaintainunicodedatabasedata typesrecordssoftwaresynchronizationtablemigrateprimaryconstraintattributeskey
Data Recover-Center

Shareware by Recover-Center
5 x 1997Kb downloads

...in a flash! The media might also be bulk erased or formatted, removing any files from storage....
 
datacardsundeleterescuehard driveflash memoryflash cardhddusb driverecovery
...to the database, also an ideal solution for bulk SMS messaging. Power users will appreciate the C#...
 
pagingpagerhttpclickatellsnppsmswctpsqlsmpptapmodemvisual basicemailgsmucp
DBConvert for SQLite & MySQL

Shareware by DMSoft Technologies
3 x 17203Kb downloads

...database. DBConvert for SQLite & MySQL provides the bulk of functional capabilities such as interactive (GUI) mode...
 
sqlite para mysqlsqlite sqlconvert sqlite mysqlmysql import sqlitemysql sqliteexport mysql sqlite
...This is standalone and robust application to decrypt bulk pdf files. # Tool is compatible with all...
 
securitycommentfillpdfremoverbatchpasswordrestrictionsadobeuserprinteditenablesignownercopyunrestrictfilesunprotectunlock
...Emailsmartz Email List Manager is mailing list management software to collect unsubscribed user email ids, sort mailing lists, merge email lists, and remove duplicate email addresses. The Email List Manager...
 
email managementemail list managermailing list softwareemail list managementbulk email list software