1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

Sort by : ReleasedNameDownloadsAddedRatingRelevance
LanDiscovery

Freeware by Softvoile
59 x 152Kb downloads

Free Vista Files award
...LanDiscovery is a free utility for browsing large local area networks. The program...
 
browserlandiscoverynetworkintranet
InternetOK

Freeware by Kandyansoft
46 x 1162Kb downloads

...This Utility Can Manage Your Internet Explorer Settings. Such as...Also Added IOK Security Center It`s Protect Your Browser Option Without Disturbing You Manage Perifixes, Browser set...
 
customizing
Windows File Explorer

Freeware by FreeSoft Labs
79 x 2640Kb downloads

...Windows File Explorer is a file manager for Windows similar to Windows Explorer. But Windows File Explorer uses a different approach: it features many options that Microsoft`s Windows Explorer...
 
viewerutilitypowerdeskwindowsnortonsalamandersystemzipexplorermanagerthumbnailbrowsercomandercommanderfilemanager
BeTrayed

Freeware by John Foster
22 x 239Kb downloads

...BeTrayed! is a small 32 bit command line utility which allows you to easily add a collection...Shared Area,SharedArea.ico ; ; Launch URL with default browser (using the 3rd icon in browser exe) http://www.mycompanyintranet.c...
 
minimize traysystem traylaunchersend traynotification area
Fast Link Checker Lite

Freeware by WebTweakTools.com
6 x 9071Kb downloads

...Lite is a free and easy to use utility that checks a site for broken links. It...
 
linksunavailablelink validatorcheckcheckinglink checkerfindinvalidwebwebsitesearchwebpage link checkerbroken
PDF SpeedUp

Freeware by AcroPDF Systems
31 x 589Kb downloads

...Systems web site, www.acropdf.com Features: Free PDF Tweak Utility for Adobe Acrobat 5, 6, 7, 8, 9,...toolbar Remove PrintMe and Adobe Reader icons Disable Browser Integration Disable confirmation dialog when closing Adobe Reader...
 
fastadobeslowstartupsettingsspeedreaderspeeduppdftweak
Easy Erase File Cleaner

Freeware by EasyErase.com
60 x 335Kb downloads

...Easily erase your temporary internet files, temp files, browser histories, and other personal information. With an option...
 
delete temp filesclean filesfree file cleanererase fileseasy erase file cleanerdelete files
Easy Thumbnails

Freeware by Fookes Software
92 x 1038Kb downloads

Free Vista Files award
...Easy Thumbnails is a handy freeware utility for creating accurate thumbnail images and scaled-down/up copies...
 
batch resizingcreatescaledownloadablethumb nailsthumbslanczos3freewarejpeggeneratethumbnailspicturesresamplingjpgeasylosslessimagesresizethumnailsdigitalphotos
Mihov Active 800x600

Freeware by Miha Psenica
13 x 212Kb downloads

...helps you see how large a program or browser window would be if resized to a screen...
 
previewwebsoftwarepixeldpiresolutionprogramfreewarescreendevelopersizemonitorutility800x600testing
IE Internet Security

Shareware by Ixis Ltd
20 x 1938Kb downloads

Free Vista Files award
...IE Internet Security is a password-protected Internet security utility that customizes different features of the Internet Explorer...you to disable abilities to change your web browser settings, restrict access to certain tabs of Internet...great ability to customize the Internet Explorer web browser for each user personally. Existing password protection will...
 
locksecurityaccesspasswordrestrictscreencontroladministratorprivacyfreeprotect
Picture Viewer .EXE

Shareware by SoftTech InterCorp
52 x 2377Kb downloads

...image viewing, PictureViewer .EXE provides a comprehensive slideshow utility supporting auto-play, custom time intervals, forward, reverse and...the dynamic playlist editor. Use the integrated file browser to navigate easily through your image files, viewing...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
HTTrack Website Copier

Freeware by HTTrack
295 x 3763Kb downloads

Free Vista Files award
...HTTrack is an easy-to-use offline browser utility. It allows you to download a World...
 
grabberhttrackaspirateur wwwsurf offlinebrowse offlinewebsite mirroringoffline browserlocal site builderweb capturewww mirror utilityaspirateur webwinhttrackweb mirror utility
SQLTools

Freeware by Aleksey Kochetov
34 x 1139Kb downloads

...information about database statistics and timing. * Object Browser is designed for getting any object DDL definition....
 
sqltoolsoracledeveloperprocedureplsqltriggerstoredpackage

Freeware by Apivision.com
34 x 873Kb downloads

...Apivision QTbar (Quick Toolbar) is Taskbar Utility for Windows Desktop. Quick Toolbar gives a user...access Internet sites (that open in a NEW browser window) but also to quickly copy, move, compress...
 
clickaccessemailspeedqtbarcomputere-maillaunchercontroltoolbarlinkinternetdesktopaddressmanagementapplicationfreewareshortcutprogram
WhoIsNot Lite

Freeware by Chami.com
9 x 1861Kb downloads

...award winning domain name (whois) / directory search utility with an user-friendly Web-browser-like navigation window. It can...
 
ftpinternetwhoisfingerdirectorywebsearchlookupdomain
Robust Internet Speed Booster

Freeware by Robustftp.com
1201 x 5044Kb downloads

...set of tools. Internet Speed Booster is a utility to help you keep your system healthy and...to prevent fragmentation of data transfers. Free Mem utility - allows you to free physical memory or...
 
connectivityfibersharewarecablefreeimproveoptimizeperformanceinternet boostfasteracceleratebumpsettingincreasefastlanebrowserutilitiesmodemspeedfreewarequick
Ki-Washer

Freeware by Kalavath Infotech
34 x 146Kb downloads

...Ki-Washer is an Internet and PC cleaning freeware utility from Kalavath Infotech. Developed using the latest Microsoft...
 
safetemp files removertemp cleanerhistorycookiesprivatebrowser cache removersecurefree windows cleanerdelete temporary fileseraseinternet cleaner
InternetFileSize

Freeware by Moveax, LLC
18 x 755Kb downloads

...and drop http or ftp link from the browser to InternetFileSize window. - drag and drop selected...
 
ftplinkget sizeutilityhttpshell enhancementinternet file sizeexplorer
Crawler Download Manager

Freeware by CRAWLER, LLC
25 x 1058Kb downloads

...fire, 3D earth, and 2D slideshow. Enliven your browser with colorful IE browser skins, choose from over...
 
free download managerdownloading toolinternet download tooldownload utilityfree downloaderfast downloadsdownload acceleratorfile managerfile downloader
Crawler Fun Ball

Freeware by CRAWLER, LLC
20 x 1248Kb downloads

...Play with Fun Ball on your desktop for FREE and access your toolbar menu with a right-click on the ball. Toss it all around, it bounces right back. Don’...
 
play ballfun toolsdesktop ballfun utilitybounce ballbreak gamesdesktop gamesplay with desktopbrowser funfun ballfunny balldesktop fun