1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Cayman Browser

Freeware by caymanbrowser.com
63 x 1677Kb downloads

...engines and 100 search categories *Flash animation filter: Block all flash ads just by a click *Website...scan: Check all Urls in a web page and show each url`s...
 
webbrowser
PixGrabber Free

Freeware by SoftInform
64 x 4296Kb downloads

...it straight from the active browser window. PixGrabber blocks ads and pop ups guided by its URLs,...dimensions or by actual image placement. When blocking the loading of banners in compliance with user...
 
image viewerimage browserstopperimage archivebookmark managerpop-up killerinternet surfing
C-Privacy Free

Freeware by C-Privacy
25 x 2441Kb downloads

...The ultimate privacy management software to Protect your Privacy, Clean the Tracks, Clear PC History, Clear the Autocomplete URLs, Delete Addresses on the addressbar. Features: ยป Cookies, Typed/ Visited URLs, History...
 
privacypopup blockerremove cookiescleanssecurityfreewareblock popups
27 Tools-in-1 Wichio Browser

Shareware by Revopoint Co., Ltd.
13 x 6685Kb downloads

...NetStat, Auto Refresh, Delete History, Cache, and Cookies, Block Pop-ups, Show your IP, Show System Resources, Auto...
 
reminderflashtranslateprivatehistorye-mailresourcelyricnetstatdictionarycookiesscreenupdatespeechfillerrefreshtraceroutewhoismapdnsvoicecurrencycacheblockalertcaptureweather
PixGrabber

Shareware by SoftInform
6 x 4209Kb downloads

...it straight from the active browser window. PixGrabber blocks ads and pop ups guided by its URLs,...dimensions or by actual image placement. When blocking the loading of banners in compliance with user...
 
internet surfingbookmark managerimage viewerstopperpop-up killerimage browserimage archive
Pop-Up Monster 2004: Mean & Green

Shareware by eXibition Software
9 x 7923Kb downloads

...your watching with their animamtions? Now you can block those pesky browser take over ads, pop-up ads,...new learning abilities Pop-Up Monster can learn what URLs are bad and add them to it`s blocked...it identify ads you don`t want * Customizable, block what you want, when you want. * Actively...searchs for ads and blocks them using proprietary technology. * Questionable Content Notification...site may contain p**n and allows you to block it.
 
adsblockerpopuppop-up

Shareware by Sestus Data
12 x 6535Kb downloads

...NEW! Internet Popup Blocker & Privacy Protector. Block popups AND protect your privacy WHILE YOU SURF...for extra privacy! NetPopper is Intelligent! Most popup blockers work by `brute force`, that is to say,...they block only those popups identified by the user. This...the `black list`. NetPopper is different. NetPopper automatically blocks all unwanted popups, silently and without any user...
 
popup blockerpop-up killernetpopper pop-up blockerpop-up stopperpopupssoftwareevidence eliminatorprivacy protectorpopup killer
...AdsNoMore is a pop-up stopper and banner ad blocker designed to eliminate all of the ads that...from Internet Explorer, Netscape, Opera, and Mozilla, and block banners which will result in faster web browsing....It also allows you to block messaging service ads from software such as Kazaa,...configure ad servers, keep a log of every blocked popup and banner, and configure sound notifications when...all blocks take place.
 
adsnomorespammsnflashnetscapeaimmozillaexploreroperablockerspywarebannerbannersicqpop-upskillerkazaawindowsadwareinternetstopperpopupsbrowser
...in the background, recording Web site titles and URLs (addresses) of Web sites viewed using Internet Explorer...record this limited information form these browsers, or block these browsers from running to force people to...
 
monitor web usemonitor internetweb securitymonitor web accessmonitor internet usemonitor web usageinternet security
...It can be used for several purposes: 1) Blocking your browser from being redirected to dangerous or...sites, such as those infected with viruses. 2) Blocking popups 3) Access control, to allow parents, schools,...blocking, so you simply have Web Site Zapper block all Web sites until you are present and...of good and bad Web site titles and/or URLs (Web addresses). You can add Web site titles...and URLs to these lists manually, or have Web Site...
 
internet access controlcontrol web browsingweb access controlparental controlchild safetyinternet safetyinternet securitypopup blockercontrol web surfing
Free Vista Files award
...without annoying pop-up ads. AntiTracer allows you to block all pop-up windows, block by fixed size and...
 
fileskillercookiessharewarehidedeletecacheprivacyblockerpop-upsecretblokersecurityprotectinternetmrulogsexplorereliminatorcontentstempwindonetscapehistorydirectoriesindexdatclipboardlist
ChildWebGuardian PRO

Shareware by Zimin IP
12 x 8507Kb downloads

Free Vista Files award
...finds some obscene content, ChildWebGardian PRO will immediately block viewing such pages. ChildWebGuardian PRO is a whole...the presence of forbidden phrases, a function for blocking the access to the sites in the "black"...of the week, a function for storing the URLs of the visited Internet resources to the special...
 
browsersurfingsafetyparental controlchildkidsinternet
PC-Controller

Demo by My WinSoft
11 x 1236Kb downloads

...PC-Controller can also be used to supervise and block words and Internet addresses. You can define one...
 
loggingwordparental controlbrowserkeyboardaccessprotectionfamilyrestrictionactivitywebuserkid safeadultmonitoringchat blockersurveillancekidshandykeyloggerchildscreen captureinternet
...favorite sites such as mySpace at school? Employer blocked most wanted sites? Sad but true - they...have full control over their firewall and can block anything. But don`t hang on - there`s still...doesn`t only unblock, but also obscures and encrypts URLs being visited, and nobody will be able to...
 
unblock myspacebypass firewallunbanproxy bypassunblock googleaccess blocked siteweb proxy service
...favorite sites such as mySpace at school? Employer blocked most wanted sites? Sad but true - they...have full control over their firewall and can block anything. But don`t hang on - there`s still...doesn`t only unblock, but also obscures and encrypts URLs being visited, and nobody will be able to...
 
access blocked siteunblock myspaceproxy bypassunbanweb proxy servicebypass firewallunblock google
BPS Popup Shield

Demo by Bullet Proof Soft
11 x 5010Kb downloads

Free Vista Files award
...BPS Popup Shield also allows you to block advertising banners that can be very annoying and...displayed in the Sites List. To see the URLs that generates popups in a specific domain, just...
 
popup blockeranti-popupeliminate popuppopup stopperdisable popupsremove popupblocks unwanted popupkill annoying popupunuseful poupkill popupadvertising banners
Porn Filter

Freeware by NetDogSoft
63 x 585Kb downloads

...Internet Pornography easily! Special Intelligent content Filtering Engine blocks porn contents on the Internet. The content filtering...any Internet applications automatically. Porn Filter also can block URLs which you have defined.(supports WildCard Characters `?` and...a word such as "porn", that means all URLs contain word "porn" will all be blocked). You...can also block all URLs except some special URLs you have decided not to...
 
kids safetyporn blockkids porninternet filterfilter pornographic web siteparental controlkids filterblock pornporn filter
C-Privacy Pro

Shareware by C-Privacy
15 x 2441Kb downloads

...The ultimate privacy management software to Protect your Privacy, Clean PC Tracks, Clear PC History, Clear the Autocomplete URLs, Delete Addresses on the addressbar. Features: - Cookies, Typed/ Visited URLs, History...
 
securityprivacyremove cookiespopup blockercleanblock popups
...control utility that allows viewing selected websites and blocks every other website. If you are concerned that...or URLs, load them into this software, activate blocking and you may be sure that Internet Explorer...
 
safe browsingwebsite blockerurl filtersafe internetblock websitekids safe browsingblock sitesblock urlfilter web contentkioskinternet kioskparental controlsinternet explorer filter
...Website Block software utility allows you to block unwanted websites from display in Internet Explorer. If...is blocked, the user is forwarded to a blocked information page or a blank page and the...on your PC. Stop loading banners and ads, block Myspace, Facebook and othe social networking sites, block...computer users can not modify the list of blocked sites and a capability of saving and loading...
 
parentalblock facebookblock youtubeblock urlblock web sitesparental controlsweb blockerblock myspaceblock sitesite blockerblock internetsite blockingblock websitewebsite blockerwebsite blocking