1 2 3 4 5 6 7

Sort by : ReleasedNameDownloadsAddedRatingRelevance
WinGuard Pro Free Edition

Freeware by WinGuard Pro Team
26 x 605Kb downloads

Free Vista Files award
...allow you to disable Task Keys, Software Installation, Internet Explorer, Mozilla FireFox, Downloading Files, Zip and Self...
 
zipexeinstalleprotectaccessapplicationsdenypassworddriveswindowsdisablefilessecurityfoldersdirectoriesencryptionprogramsdirectoryblocksecuredialog
ABF Internet Explorer Tools

Shareware by ABF software, Inc.
14 x 1094Kb downloads

Free Vista Files award
...ABF Internet Explorer Tools is a set of very useful plug-ins...for the popular MS Internet Explorer browser. The software contains a tool bar, page...of additional commands, such as: refresh ignore cache, block popup window, and so on. This product is...information from the World Wide Web easily. ABF Internet Explorer Tools is interesting for any kind of...
 
toolsblockabfexplorermagnifiermagnifyimagessavewindowsinternetrefreshbrowserutilitespop-ups
Free Vista Files award
...sounding a distinctive ring. It can also automatically block unwanted callers (like telemarketers) using your own private...list of blocked callers as well as optionally with the help...of nuisance callers. In addition CallClerk can perform internet reverse number look ups and run other programs...including speed dialing, clipboard dialing and dialing from Internet Explorer and Firefox. If you use Microsoft Outlook,...
 
machinecallercaller softwareemailtapireverseansweringcalleridblockmodemfaxphoneprogram
Popup Killer

Shareware by DigitByte Studio
16 x 376Kb downloads

Free Vista Files award
...windows when you surf the internet. It also blocks Windows Messenger in Windows XP/2000/NT which interfere with...up each time, saves the bandwidth of your internet connection and your time. The main features include:...Block unsolicited pop-up ads. Block Messenger popup spams for Windows XP/2000/NT. Speed up...browsing Never interfere with user`s normal navigation. Save internet bandwidth Automatically launch when windows starts up. Robust...
 
kill adskill popupblock spamsonline privacyanti spamkill spamskill popup messengerpopup stopperpopup killerpopup blockerblock ads
FineBrowser

Shareware by SoftInform
10 x 3415Kb downloads

...browser window. It includes features for annoying popup blocking and clearing any trace of web surfing. The...Also FineBrowser is capable to download pictures from Internet without visiting sites using web site`s addresses, image`s...
 
internet explorerinternet surfingblock pop-upbookmark managerpop-up killeralternative browsermultibrowser
AdsCleaner

Shareware by SoftInform
21 x 4123Kb downloads

Free Vista Files award
...a perfect ad stopper and pop up blocker. Block ads and clear all tracks of your online...activities. In addition to the possibility of blocking ads by URL-masks included into black list AdsCleaner...has obtained the ability to block banners, which have specific dimensions. A user can...set a range for dimensions that would allow blocking the banners whose dimensions differ a bit from...standards.
 
manage internetbanner killerpop blockerads blockads removerads killerblock adsblock poponline privacykill adsadscleanerload multiple web pagespop stopperpop killer
Outlook Express Backup Tiger

Shareware by Bimesoft
11 x 698Kb downloads

Free Vista Files award
...e-mail and news data, hotmail messages, accounts, rules, block senders, signatures and options. In addition, it can...backup the global Windows address book and Internet Explorer Favorites. Outlook Express Backup Tiger supports OE versions...
 
backupoutlook express
SXBandMaster

Shareware by SAARIXX LABS
15 x 3275Kb downloads

...SXBandMaster is designed for Internet services maximum use. It is a program complex...with FXP support, Time Synchronizer (Atomic Clock), Traffic Explorer and many others. SXBandMaster excels it`s substitutes in...copying, deleting files and folders) using usual Windows Explorer interface. Clipboard and drag&drop support. Traffic Explorer. Monitors...and receive from the Internet. Registered version can block or just delay downloading or uploading.
 
schedulingsynchronizerofflineatomicmanagertrafficuploadinghttpdownloadingwebsynchronizationmirrorclockdialerinternetexplorerjavascriptspidersnifferfxpftpbrowser
iNetAdviser Professional

Shareware by SoftInform
9 x 4299Kb downloads

...bookmarks. It includes features for ads and popup blocking and clearing any trace of web surfing web...Also iNetAdviser is capable to download pictures from Internet without visiting sites using web site`s addresses, image`s...
 
alternative browserinternet surfingblock adscompanionweb pagesmultibrowserpop-up killerbookmark managerblock pop-upinternet explorer add-onsads stopper
Pop-Up Stopper Anti-Spyware

Shareware by Panicware Inc.
22 x 4426Kb downloads

Free Vista Files award
...or jumps out from under your browser, we`ll block it. Period. You can report ads that we...block, and we will update the product to block them. We block ads served by spyware and...adware files. Also includes optional toolbar for Internet Explorer, Cookie Manager and complete cleaning of common...spyware and adware protection for every browser and Internet connection. Also included are advanced ad-blocking options for...
 
spyware killeradwarepop stopperpopup killerpop blockerstop spywarepop-up
KidSplorer Web Browser

Shareware by Devicode Technology
12 x 1074Kb downloads

...Program features: Set KidSplorer as your childs default internet web browser. Add remove web sites from your...
 
limitcontrolssoftwaremonitorparental controlprotectchildrenweb browserblockfilterexplorerkid safeinternetkidsafe
AntiSpy

Shareware by Omniquad Ltd
13 x 12083Kb downloads

...spyware install hooks to monitor keyboard activity & internet activity, these hooks always run in the background...Scanning, User friendly interface to manage quarantined Spyware, Internet Explorer home page shield, Downloads product updates automatically,...you to keep, delete or quarantine. It preemptively blocks spyware using its ActiveX Block list functionality. It...that is trying to install itself.
 
securityadvertgatorfreewarebhogroksterdestroydialerremoveprotecteliminateadwarekeylogantispydetectmalwarebrowser hijacktrojanspyware
SiteCafe

Freeware by PROVISIO LLC
32 x 31003Kb downloads

...The SiteCafe software was developed in particular for Internet and Cyber cafes. It allows you to centrally...computers within a local network or on your internet server. Operators will be able to bill their...Manager to monitor and, if necessary, unlock or block the clients at any time. SiteCafe can also...be used to manage remaining credit obtained by Internet automats with coin insertion. The installation and configuration...
 
internetcafecyber cafe softwaresoftware for internet cafesoftware for internet cafesinternet cafe softwarecybercafe softwareinternet-cafeinternet cafe managerreportinginternet timercomputer timer
...tries to send a popup, and lets you block it or allow it with the click of...lets you choose whether to allow or permanently block popups from that site. Press Win+Z to allow...at startup. Minimizes to the System Tray and blocks popups without interfering with your browsing. Click the...or exit the program. Can be added to Internet Explorer`s "Tools" menu for quick and easy access!...
 
blockerblock popups
...AdsNoMore is a pop-up stopper and banner ad blocker designed to eliminate all of the ads that...stop adware and spyware pop-ups, web popups from Internet Explorer, Netscape, Opera, and Mozilla, and block banners...faster web browsing. It also allows you to block messaging service ads from software such as Kazaa,...configure ad servers, keep a log of every blocked popup and banner, and configure sound notifications when...all blocks take place.
 
adsnomorespammsnflashnetscapeaimmozillaexploreroperablockerspywarebannerbannersicqpop-upskillerkazaawindowsadwareinternetstopperpopupsbrowser
PopUp Ad SmasheR

Shareware by www.PopUpStop.com
10 x 1652Kb downloads

Free Vista Files award
...to automatically stop pop-up ads and all other internet annoyances. For example it will stop animated flash...and "Smart Allow" options. Other features include erasing internet traces when closing your last Internet Explorer, password...protect Internet Explorer and block offending material (web content filter). This is one...
 
internethistorystop popupspasswordcachebannerbrowseradsonline privacywebbugprotectionwindowcookiescleanexplorerweb bugsutilitiessecuritypop-ups
Internet Explorer Password

Demo by LastBit Software
19 x 61Kb downloads

...Internet Explorer Password is a password recovery program for IE...this feature is basically useless, and may effectively block the usage of Internet Explorer. If you lose...Content Advisor, you will be unable to use Internet Explorer, since most websites have no rating at...all. Internet Explorer Password solves this problem by recovering a password...
 
recoverypasswordcrackeradvisorexplorerinternetcontent
PlanetRemote Plus

Shareware by NewAce Corporation
13 x 10365Kb downloads

...web browser from any computer connected to the Internet or your local network (LAN). PlanetRemote will automatically...assign your computer a static Internet Name that tracks your computer`s current IP address...remember name. You can also choose your own Internet Name or use your own domain name. PlanetRemote...password failures can be automatically added to your block list. You can access your files using your...
 
remote controlremote desktopremote managementvirtual network computingremote accessremote computingremote administrationvncdesktop sharing
...IE Guardian allows you to customize Internet Explorer (IE), protect your IE settings against changes and...Prevent others from editing your Favorite list. Disable Internet Options changes, such as home page, Dial-up or...IE Guardian gives you total control over your internet explorer web browser settings....
 
blockercustomizeprotectpreventpopinternet explorerlogoweb browser
IEToolKit

Shareware by GoUpSoft Inc.
12 x 1231Kb downloads

...IEToolkit is an add-on for Internet Explorer, that adds a new toolbar with several...System requirements: Microsoft Windows 95/98/Me/2000/XP/2003, Windows NT 4.0, Internet Explorer 5.02 or above....
 
turn onoff flashsave flashpicturessave mhtintelligent popup killeranimations and sounds