1 2 3 4 5 6 7 8 9 ... 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...anubis. In this example source codes, the symmetric block cipher chaining mode used is CTR (Counter Mode)....
 
tomcryptlibraryfileencryptioncipherswindowssymmetric
Call Alert!

Freeware by Pingram Marketing
40 x 540Kb downloads

Free Vista Files award
...person is calling. With Call Alert!, you can block telemarketers (or any other unwelcome callers) easily: simply...
 
telephonytext speechttscidtalkingcall alertfreewaretelephonemodemnumberannouncevoicetapicaller
Panda Cloud Antivirus - Free Edition

Freeware by Panda Security
3 x 301Kb downloads

...latest unknown viruses. This new version includes behavioral blocking to prevent viruses from launching suspicious actions. It...based on ultra light architecture to process and block malware more effectively and efficiently than traditional products...
 
freeonlinespywarerootkitantivirus
Compact Outlook Express Backup

Shareware by AlmerSoft
10 x 1748Kb downloads

...general settings, signatures, rules, and a list of block senders as well. It`s up to you what...
 
outlooksynchronizeencryptionarchivebasebackupsexpressmessage
Acronis VMProtect

Shareware by Acronis
1 x 212992Kb downloads

...(VADP) to provide agent-less backup & recovery, change block tracking reduces traffic on LAN and load on...
 
vmware protectionbackup warerecoveryback vmwarevirtual machine backupp2v backupacronisvmware imagingvmprotectvmware backup
IP Messenger Spam Blocker

Freeware by Amplusnet
31 x 441Kb downloads

...protection against Messenger pop-up ads! IP Messenger Spam Blocker prevents IP messages from appearing on your machine....to be browsing the web. IP Messenger Spam Blocker prevents IP messages from appearing on your machine....IP Message Spam - Download IP Messenger Spam Blocker Invisible Browsing will also protect you by blocking...an efficient Internet Explorer Privacy Protection and Popup Blocking Solution that automatically erase, in real time, all...
 
pop-up window spamamplusnetmessagingmessenger spam blockerpop-up window advertisingmessage spam stoppernet send spam
...more. IpMasterPro integrates the IpWallMaster Firewall for point-and-click blocking on-the-fly. For you Gamers... IpMasterPro gives you total...tracking every player in your gaming servers. Log blocked Ip(s) as they try accessing your game server....
 
serveripmasterpronetworkfirewallgamesmgmttcpipipwallmastermonitor
Privatefirewall

Freeware by Privacyware.com
13 x 3656Kb downloads

...models and monitors system behavior to identify and block activity characteristic of known malware, hacking, phishing and...
 
firewallpersonal firewallsecurityanti-keyloggerprivacyanti-loggerfree personal firewalldesktop firewallhips
GSA Email Verifier

Shareware by GSA
11 x 10930Kb downloads

...bounced addresses because a lot of mail servers block the senders IP address for repeated sending of...email marketing and to avoid ISPs mail servers blocking or banning your email domain because of you...
 
email validateverify emailcheck emailsmail validatoremail listemail verifier
Max Spyware Detector

Shareware by Max Secure Software
41 x 46732Kb downloads

Free Vista Files award
...exclude any software from getting scanned. You can block the bad websites using Host file thus making...
 
adware removalremove spywarescan spywarespyware removalanti spyware softwareclean braviaxfree spyware checkfree anti spyware downloadclean system security 2009detect spywareantispywarefree online spyware scancheck for spyware
Max Secure Spyware Detector

Shareware by Max Secure Software
24 x 11075Kb downloads

Free Vista Files award
...exclude any software from getting scanned. You can block the bad websites using Host file thus making...
 
free online spyware scandetect spywarecheck for spywarefree anti spyware downloadanti spyware softwareantispywareclean braviaxscan spywareclean system security 2009free spyware checkspyware removalremove spywareadware removal
ISA Stats

Shareware by RIA-Media
12 x 3407Kb downloads

...sites. One of the main functions allowing to block an access to certain sites (in case of...
 
statsisa
...sectors, partition table corruption, disk initialization, master directory block or volume header corruption, catalog file corruption and...
 
mac recovery softwarehfs recoverymac data recovery softwaremacintosh recovery softwaredata recovery macrecover mac filesapple macintosh recoveryrestore mac datamacintosh data recoveryrecover mac data

Shareware by Dewqs` Tribes
9 x 3710Kb downloads

...NMS for Outlook! New For non-English speakers: Can block any email written in English! Nuevo: puede bloquear...
 
emailinternetwebspamfilter
PixGrabber

Shareware by SoftInform
6 x 4209Kb downloads

...it straight from the active browser window. PixGrabber blocks ads and pop ups guided by its URLs,...dimensions or by actual image placement. When blocking the loading of banners in compliance with user...
 
internet surfingbookmark managerimage viewerstopperpop-up killerimage browserimage archive
TrustyFiles P2P File Sharing

Freeware by RazorPop
49 x 1604Kb downloads

...small 1.6MB total download. Security features include a blocklist to protect from invasive users and virus scanning...support to block infected files. TrustyFiles` advanced P2P engine provides simultaneous...
 
freewaresig2datgnutellabit torrentmp3peer peermusicclientgamessearchmagnet linkfilessoftwaresharewaremorpheustransferp2p linkkazaavideop2p file sharing
...are no viable technical solutions available for p**nography blocking at the gateway. NetOptima Professional stops p**nography before...it enters your network. NetOptima Professional key features Blocks p**nography, 99.9 percent accurate, Server implementation, Domain Filter,...is websites, emails, blogs or community/networking websites without blocking entire website. NetOptima is up to 99.9 percent...
 
web filteringpornography problemsfree web filter trialfree block pornographynetwork pornography filterinternet pornography filterfree parental control
...displays priority optimization for currently active application. Built-in block list of applications which are not compatible, to...
 
itopsoft speeduperspeed boostlaunchers task managerssystem utilities
Game Accelerator

Shareware by DefendGate Inc.
38 x 243Kb downloads

...computer experience even smoother, an intelligent pop-up ad blocker is included to block those annoying spam pop-up...to keep your laptops running longer -Integrated pop-up blocking capabilities to get rid of those annoying pop-up...
 
accelerategamesspeedfastercardperformancevideosound
PixGrabber Free

Freeware by SoftInform
64 x 4296Kb downloads

...it straight from the active browser window. PixGrabber blocks ads and pop ups guided by its URLs,...dimensions or by actual image placement. When blocking the loading of banners in compliance with user...
 
image viewerimage browserstopperimage archivebookmark managerpop-up killerinternet surfing