Sort by : ReleasedNameDownloadsAddedRatingRelevance
EfreeSoft Boss Key

Freeware by EFREESOFT
264 x 661Kb downloads

...immediatlly using a hot key!You can hide the browser windows,folder windows,applications windows,all your desktop icons and taskbar...
privacyhideboss key
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Paessler URL Recorder

Freeware by Paessler AG
92 x 740Kb downloads

...POSTDATA strings that a user sends to a web server while surfing a sequence of URLs. like a standard web browser, whereby you enter a URL at the...
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml

Freeware by CodeThat.Com
94 x 255Kb downloads

Free Vista Files award
...CodeThatForm package gives you full control over the windows in browser. You can control the style, appearance, content, positioning and sizing of the window. Creation of the windows never was...
javascript windowdgtml formjavascript form

Freeware by Iconico
80 x 341Kb downloads

...for Internet Explorer allows you to log into websites using a single mouse click. Version 1 to someone else, or add to a website - Once created the EasyLogin bookmark will any modern browser - Tested on many websites including gmail, yahoo and aol - Totally free,...or spyware To Use EasyLogin go to the webpage where you would like to log in and...
Sponsored Ad Blocker

Freeware by
78 x 3193Kb downloads

...Sponsored Ad Blocker™ protects the relevance of web searches by blocking often misleading and annoying sponsored...
browser extensionblockersearch
m9P Surfer

Freeware by mental9Production
127 x 2435Kb downloads

...m9P Surfer is a very fast light weight web browser developed by mental9Production! This web surfer is...the options and functionalities expected from a modern web browser, m9P Surfer provides complete internet surfing capabilities....
explorerweb browserinternetnavigatorsurfer
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...completely new and unique way of updating your web site. Portello is a plug-in to Internet 65 mph! Press the button and your web page as you see it becomes editable, exactly...your changes will be saved instantly to the web server. You can cut, paste, create links other ways edit your web page. You can add, rescale and compress new...and folders between your local drive and the web site like you would with any FTP client....
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...statistics charts and reports in real-time using a web browser, or using the NoSpamToday admin application. Data...
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server

Freeware by
74 x 995Kb downloads

...Save information from the Web in an organized manner. NetPicker gives you select and save a portion of the web page by dragging it from your browser. NetPicker...
save informationweb information

Freeware by Scand
78 x 49Kb downloads build a user friendly interface for a web application. dhtmlxToolbar is an advanced JavaScript navigation You don`t have to care about the browser compatibility problems. dhtmlxToolbar works perfectly in all main...
toolbar builderdhtml toolbarweb toolbarjavascript toolbartoolbar creatorcustomizable toolbarjavascript componentweb developmentfree toolbartoolbar makejavascript navigationscandcreate toolbar
Pop-Up Stopper

Freeware by Panicware Inc.
170 x 414Kb downloads a list. Pop-Up Stopper will not strip web images or slow your browser. You can allow...
stop pop-upsstop popupssurfingx10popup stopperpopup windowspopup killerinternetpop-up stopperfiltereliminate popupspop underpop-up killerpop stopper
Active Web Reader Customizer

Freeware by DeskShare
55 x 59Kb downloads

Free Vista Files award
...With the Active Web Reader Customizer you can now distribute your own...RSS reader that includes your feeds and web pages. The user then simply downloads your custom...reader, preloaded with your RSS feeds, increasing your website visibility.
A Customized setup of Active Web...Reader is ideal for Websites who want to frequently provide news, product updates,...
customizable rss aggregatorbranded rss aggregatorcustom rss reader

Freeware by Arovax LLC
135 x 1685Kb downloads

...the registry, hijack or install itself into a browser or find any other way to stealthy get...
security disablerstrojan virusessecurity breachsecurity vulnerabilitylive monitorkeystroke monitorsspyware monitoradwarebrowser hijackerssystem monitorspage hijackersfirewallspyware threat
RSSOwl - Powerful RSS / RDF / Atom News Feed Reader

Freeware by RSSOwl
125 x 4000Kb downloads

Free Vista Files award
...RSSOwl is a free RSS / RDF / Atom Newsreader in Java using SWT as fast graphic library. RSS ("Really Simple Syndication" or "Rich Site Summary") is a document specification that gives...
aggregatorfeedaggregatorjavafeedreadereclipserdfopmlopen sourceswtatomportablenews readerrcprssnewsreadersnewsaggregatorfreenews aggregatortraycross platformsynchronizationnewsaggregators
Cayman Browser

Freeware by
77 x 1677Kb downloads

...Improve your Internet surfing with this tabbed, innovative Web browser today! Cayman Browser incorporates a large collection...features , it can speak, translate, open multiple web pages at the same time, and more: * one place *Power Group: Login to various web sites, forums, blog servers by only one *Website scan: Check all Urls in a web page and show each url`s create date, file...
PixGrabber Free

Freeware by SoftInform
74 x 4296Kb downloads start from and the level of image-containing web pages nesting. Also you can download images using...allows adding your personal comments to the current web page and bookmark it straight from the active...easy to avoid useless visiting of the same web pages all the time....
image viewerimage browserstopperimage archivebookmark managerpop-up killerinternet surfing

Shareware by Stormdance
67 x 1379Kb downloads

Free Vista Files award
...Translate web sites without worrying about the HTML code. CatsCradle...language translators and translation agencies - a dedicated web page editor that makes it very easy to...translate web pages from one language into another. CatsCradle grabs...all the text that requires translating from a web page, puts it into a built in editor...automatically integrates your translated text back into the web page - leaving all the sensitive HTML code...
localisingwebtranslatortranslatingcatscradletranslationlocalizationlocalisationlocalizingweb pageweb page editorhtml

Freeware by Moog Software
134 x 18000Kb downloads

Free Vista Files award
...even on DHCP dynamic-ip internet connections and the browser accessible server allows a quick download of a...scaling and unlimited port-ranges. Use the full featured web client from any standard internet browser when in...
http proxyremote accessremote control softwareremote computer controlremote administrationtelecommutingremote administrator

Freeware by
148 x 648Kb downloads

Free Vista Files award
...Now you can watch over thousand live worldwide channels (1700+) on your PC, free of charge. TV is an extremely easy to use application and anyone can find their own...