1 2 3 4 5 6 7 8 9 ... 37 38 39 40 41 42 43 44 45 46

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Avi2Dvd

Freeware by Trust Fm
540 x 36331Kb downloads

...2) Choose your Audiostream. 3) Choose your output type (dvd/svcd/vcd). 4) Pick your favorite encoder (Quenc /...files like this avi2dvd will join these avis automatically and wil produce an unique film . This...
 
guidvdsvcdvcdavi2dvdconvertorderaviogmmkvdvd
Mimosa Scheduling Software Freeware

Freeware by Mimosa Software Ltd.
189 x 1360Kb downloads

Free Vista Files award
...scheduling software application for creating timetables in any type or size of school or university. It can...help. You can choose whether you create timetables automatically or interactively and you can create them in...domain since you can define the needed resource types and calendar schema according to your own special...
 
schedulesoftwareschooltimetableuniversity
PhraseExpress Text Expander

Freeware by Bartels Media GmbH
134 x 3803Kb downloads

Free Vista Files award
...phrase to a much shorter abbreviation. Whenever you type in the assigned abbreviation PhraseExpress will automatically replace...
 
abbreviationabbreviationsautotextsphrasessignaturessnippettypingautocompleteshortcutshortcutsclipboardsnippetspredictivehotkeyautocorrecthotkeys
...duplicate remover to find duplicate files of any type - find duplicate music files, find duplicate songs,...
 
find duplicate filesrenamemp3delete duplicatesduplicatedremove duplicatesorganizermusicfind duplicatessoterclonedelete duplicate filesremove duplicate filessongssort
...allows you to build a travel-related screensaver. Just type in the name of any place you would...Disneyland or Tropical Island), and the program will automatically retrieve related images from the Internet. You can...
 
tripislandplacesdisney worlddisneylandescapefavoritetravelscreensaverenjoyvacation
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...correct tags right at your fingertips. Code Completion automatically suggests tags as you type them, preventing unclosed...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
ABC Kid Genius

Freeware by kidgen.net
32 x 34181Kb downloads

...to use the keyboard. Progress and learn to type the alphabet, numbers and counting. Rotating flash word...
 
learnlapwarechildrenenglishlessonsspellingcountingalphabetreadingteachchildrensabcfreewaretoddlerseducatenumbersclasseseducationbabiesfree softwareeducationalearly learning
BySoft InternetPal

Freeware by BySoft
113 x 892Kb downloads

...is 32-bit win95/98/NT/2000/XP program for monitoring Internet connection. Automatically monitors calls and detects connection types. It runs...main window: - time on line - connection type - average upload and download speed - total...
 
transfercostchartconnectionuploadspeeddialuponline timernetworkbysoftaveragerategraphinternetbandwidth

Freeware by Seekar Ltd
166 x 1829Kb downloads

...host your channel and meet new friends. Ares automatically finds more sources and downloads files from many...
 
p2pmp3aresdivx
LockDisk

Freeware by klonsoft
128 x 1186Kb downloads

...Creates multiple encrypted virtual drive to store any type of data. It`s powerful encryption ensures that only...any file into the LockDisk Vault. It is automatically encrypted. It`s that simple! LockDisk vaults can only...
 
file encryptionsecurity encryptionfree encryption softwaredisk encryptionfree encryption programvirtual drivedata encryption softwareencryption and privacy
Computer History Viewer

Freeware by Elongsoft Software
224 x 384Kb downloads

...linger on your hard drive.Each time that you type a URL in the address bar or click...in Internet Explorer browser, the URL address is automatically added to the history index file.With Computer History...History, Internet Explorer`s cache, cookies, history, visited URLs, typed URLs, autocomplete memory, index.dat files, and much more.Double...
 
windows historyinternet explorer historyweb historyview historybrowser historyhistory viewercomputer history
Backup Deluxe 2005 SE

Shareware by FlexibleSoft Co.
55 x 4423Kb downloads

...of your system resources to it. Several backup types allow still better resource management. By combining normal...takes less time and resources. Backup Deluxe will automatically restore your data from the last incremental backup...sequence up to the last normal backup. This type better tracks data changes. After you chose backup...can limit the backup range to particular data types and file names. Masks with wildcard support will...
 
filedatadvdsystembackuptaperestoresoftware
Zilla CD-DVD Rip N` Burn

Freeware by Zillasoft.ws
69 x 124Kb downloads

...in files onto icons on the desktop, start automatically with windows start up, Create Discs from a...
 
burningcreatoraudiocddvdauthoringcreate custom compcopy dvd pro rippercar stereocapturingclick-to-disccd-rwbest dvd rippercdrwclick-to-diskburneraspibuildcdvdcapturealbumcd-recorder
Software Brat Clipboard Utility

Freeware by Software Brat Inc.
69 x 3386Kb downloads

...most recently used stack for later use. Any type of clipboard item, including files, folders, text, and...can occupy excessive memory, their preview images are automatically and transparently compressed when not being viewed. The...
 
multipleclipboard utility
Split-IT

Freeware by Info2000
43 x 8436Kb downloads

...spanning. You may use Split-IT with any file type (.exe, .zip, .jpg, .gif etc) of any dimension...file will be recomposed by a batch file automatically created. You may also find into the installation...
 
utilityfilesemailinfo2000utilitieszipsplit
Emsa Register Dll Tool

Freeware by EMSA SYSTEMS LTD
72 x 937Kb downloads

...we could not find other tools of this type to be comprehensive enough. This program provides extensive...same folder, and it will also be opened automatically for viewing. This program is Freeware....
 
activex unregisterdll registerdll registrationactivex register
Tiny Toolbar

Freeware by SoftCab Inc
32 x 312Kb downloads

...near the top of the screen where usually type web addresses to surf the Web). Search add-on...
 
addonexplorertoolbarbrowserplugininternetbutton
...for ADO programmers. It presents viewers for all types of ADObjects. bAsking is better than debugging! It`s...takes any bAsk-visible object as its argument. It automatically detects the type of the object and routes...
 
databasesbaskvb5vb6blueshell ado survey kitvisual basicactivex
PhoneTray Free

Shareware by Traysoft Inc.
118 x 12733Kb downloads

Free Vista Files award
...set a different ringtone for each caller or type of callers - select from 20 included ringtones...- date, time, name and number. PhoneTray can automatically zap telemarketers with a special number disconnected tone....calls from specific numbers or reject any other type of unwanted calls (blocked number, out of area...
 
announceanti-spamcallercidtelephonytelezappertelemarketingvoicetapicalleridanswertelemarketersphonespeechringtonesmodem
BitPump

Freeware by AnalogX
86 x 432Kb downloads

Free Vista Files award
...integrated into Windows explorer as a .torrent file type to automatically handle .torrent download files, providing a...
 
bit torrentseeddatabit pumpp2pbitpumpcontentslicespeer-to-peerbitsanalogxfilepiecestransferserverbittorentpeer peer