1 2 3 4 5 6 7 8 9 10 ... 19 20 21 22 23 24 25 26 27 28

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Akti Planner

Shareware by Aktisoft
14 x 1482Kb downloads

...Hierarchy tree for appointment types. Visual day editor. Auto scheduling. Easy to use drag & drop user...statistic. Quick info about average/total time usage from start of the selected month. Video tutorials and complete...
 
pimscheduleorganizeragendaday planner
Auto Backup

Shareware by Han-soft Software
19 x 1809Kb downloads

Free Vista Files award
...create multi-tasks to backup your data.You can use Auto Backup to make a reserve copy of any...files to restore to original or new location. Auto backup Integrated compression and password. You can create...time are specified to backup automatically. You can start backup and restore manually at any convenient time....new folder at a remote FTP server. - Auto Backup can work as a Windows NT/2000/XP service(Only...are specified to backup automatically.
 
auto backupautomatic backupftpservice
Convert TXT To PDF

Freeware by Business Software
3 x 960Kb downloads

...* Cool and professional interface, One click to start converting. * Convert in shor time and Create...* Acrobat compatible encryption and rights protection; * Auto open PDF file after creation;...
 
easy useguiwordconvert txt pdfhtmltxt2pdfpdf converterconvert pdfacrobattext pdfcreate pdf from txt
7Way Email Checker

Shareware by 7Way Software.
18 x 512Kb downloads

...mail headers, delete mail remotely, dialup and hangup automatically and configure unique sounds for each e-mail account....interval of check. Delete email remotely without downloading. Auto dial-up and hangup. Flash tray icon notification. Sound...notification. Start mail client when mail arrives. Customize the tray...
 
notifymail bombantispam tool7wayemail checkerpop3worm
Afinion Project-Viewer

Commercial by Afinion AG
20 x 49148Kb downloads

...Filters for most used selections are available and auto filters. Project-Viewer is running on Windows, Mac OSX,...can be protected so users cannot change configuration. Start screen can be changed for own needs. Afinion...
 
viewer for mppmpp viewerviewer for microsoft projectviewer for excelafinionproject viewerproject-viewerproject integrationmicrosoft project viewersap viewerviewer for project
A Webmaster Thumbnail Cruncher

Shareware by Wolfgang Software
11 x 1357Kb downloads

...Easily set the thumbnail picture size along with automatic renaming options. Auto landscape resizes thumbnails if the...a destination file path. Preview thumbs while processing. Start processing images so you can do more important...pictures. Step #2 Size and preview. Step #3 Start automatically creating thumbs! It`s just that easy with...
 
image processingmake thumbnailsweb site designweb masterpicture processingcreate thumbnailsimagesutilitiesthumbnail processingweb page makerweb designwebmaster
Clean It

Shareware by Skylark Utilities
20 x 401Kb downloads

...52 available icons. Includes one click Plug-In setup, auto run, and silent cleaning making Clean It the...from your computer. Download Clean It now and start using it today!...
 
wipeeliminateskylarkclean-itshredscrubcachedeleteeraserinternetprovinceprivacycleanit
...transparent, tweak lots of desktop settings, customize the Start menu, and enable several hidden performance options. The...and display adaptors. The System Optimization Wizard will automatically inspect your computer`s hardware, and fine-tune the Windows...control over what programs are launched when you start your computer. In addition to letting you easily...manage the programs in your Start menu, the program also gives you access to...
 
optimizingregistrytweakingad-blockerwindowsperformancezip recoverypop-uptweak-xp
cpTracker Lite

Shareware by Berthume Software
9 x 5258Kb downloads

...(cross reference), Tested On (date), Deadline (date), Planned Start (date), Planned End (date), Actual Start (date), Completed...
 
task managementtask trackingproject managementbug tracking
Auto Power-on Shut-down

Shareware by Lifsoft,INC
29 x 1490Kb downloads

Free Vista Files award
...state - Allows you to control your computer auto start up and work in appointed time. It can...standby/hibernate, shutdown/reboot, etc. at any designated time . Auto Shutdown - There is a feature of Auto...may find useful. It will allows your computer auto shut down at specified time. Keyboard/Mouse Macro -...
 
turnauto shutdown
NeighborhoodIdentifier

Shareware by DigiArch.org
9 x 1247Kb downloads

...address etc. Next the profiles will be launched automatically at start-up. Specifically for Laptop users Neighborhood Identifier...
 
launchprofileutilityneighborhoodnotebookstartessentialbatchlaptopsettingstools
iJoysoft DVD to iPhone Converter

Shareware by iJoysoft Studio
2 x 29798Kb downloads

...Convert any clip or segment by setting the start point and duration, or customize output file size...
 
put dvd iphonedvd iphone videodvd iphone converterconvert dvd iphonerip dvd iphone
DAF/FAF Assistant for Windows

Shareware by ArtefactSoft
19 x 686Kb downloads

...and restores them when it is restarted. The Auto Start feature when enabled will start the sound playback...shortcut key to the DAF/FAF Assistant application and start the DAF/FAF by pressing a single shortcut key....
 
speechaltered auditory feedbackfrequency altered feedbackanti-stutteringfaftherapydaf
MessengerLog 8

Shareware by foryoursoft.com
26 x 930Kb downloads

...icons, font and colors... The chat monitor system auto start when there`s new chat session occurred, you do...features than ever before, such as, a improved auto chat log uploader, via email or FTP, suitable...chat log search engine. It also comes with automatic online updating feature, and 15 color themes. Main...with Windows Vista, Windows 7 and Windows 8. Automatic upload chat log by email or FTP. Support...
 
chat logchat monitorchat recorderrecord chat
Flash Back

Shareware by MSK
17 x 1550Kb downloads

...Flash Back is a powerful yet easy to use backup application. Various backup & restore modes, scheduling and encryption. Flash Back features backup collection creation for easy retrieval of backup sets....
 
easybackup software flash backsecuresharewaredatarestore
FrostWire Acceleration Tool

Freeware by P2PAccelerators
43 x 2106Kb downloads

...intervals; -Configuration from last run is saved and auto loads on start-up; -Interface is easy operable by...
 
mp3accelerationsharingfilefrostwiretoolinternetsearch
TikTokToDo

Shareware by MGCSoft
10 x 1615Kb downloads

...work as you would with a kitchen using auto start - as soon as you place a timer...the sequence starts running. Or in manual mode, place your timers...and press the start button or space bar to being the sequence....Appropriate defaults for selected time spans are applied automatically but anywhere between one second and two weeks...
 
dual timertiktokcookcook alarmstiktoktodotictoccookmultiple timerkitchen timercooking alarmscountdown timerticktockcookkitchen alarms
...the slider, cautiously by drag the slider, and automatically by click the start (play) button. 5. You...all at the same time by using the auto function. 6. You can change the background color...time) by click the eight direction buttons, and auto move by click the start (play) button. 8....
 
jpegjpgimagealphagraphicsphototransparency
ACDSee Plugin -  DeskTop Author

Shareware by ACD Systems
17 x 9165Kb downloads

...image management software. Try DeskTop Author today and start making photo albums, catalogs, brochures and e-books quickly...
 
ecatalog makerecatalog softwareecatalogueebook softwarephoto albumebrochure makerebrochure software
Ip Madness

Demo by Omalogic
13 x 2391Kb downloads

...(Emails your IP address to a buddy/Client etc) Auto Update (Get auto updates of the latest version...(Monitor basic actions by the user and IPs) Auto Start (Option to run program when computer starts)...
 
madnesslocaltooltrueprotocaladdressutil