1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
FineBrowser Free

Freeware by SoftInform
71 x 3958Kb downloads

...lock the important windows from accidental close and rename them with ease. The powerful bookmarks manager offers...
 
pop-up killerinternet explorermultibrowserinternet surfingalternative browserbookmark managerblock pop-up
Softe APE to MP3 Converter

Freeware by Softe.net
15 x 1502Kb downloads

...Softe APE to MP3 Converter is a powerful audio converter for APE to MP3 conversion. Features: Convert APE to MP3. High speed and high quality sound conversion. Build-in free...
 
ape mp3 converterconvert ape mp3
MP3BookHelper

Freeware by Vlad Skarzhevskyy
84 x 2513Kb downloads

Free Vista Files award
...files in Winamp while editing Tags. It will auto pause and resume Winamp when renaming or updating...
 
freedbgnurenameopen sourcespeexogggplmp3batch editopensourceid3v2csvplaylisttaggeraudiobookeditorm3usfvflacid3v1
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...you to rotate, resize, print, delete, copy and rename your image files quickly and efficiently. Use the...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Picture Studio .EXE Professional

Freeware by SoftTech InterCorp
53 x 3076Kb downloads

...some last minute effects such as sharpening, or auto contrast – The integrated Image Converter .EXE makes...creating a unique style for your photos! Batch Rename .EXE, conveniently allows you easily rename your digital...set – allowing thousands of files to be renamed effortlessly. Regardless of your needs Picture Studio .EXE...
 
gifbmpplaylistpicturedisplaywallpapergraphicsjpgslideshowphotoimageviewertif
FontRenamer

Freeware by A. & M. Neuber GbR
53 x 51Kb downloads

...FontRenamer is free and renames truetype font files (*.ttf) to the real name...select a folder of font files and click Rename button. »Arial bold italic.ttf« instead of »arialbi.ttf« or...»Brush Script.ttf« instead of »brushscn.ttf«. FontRenamer is available in English and German language (auto...
 
typefacefreettffontmanagerreplacetypografrenamefontsfilenametruetype
JukeBox Decoder

Freeware by BirdCage Software
43 x 3472Kb downloads

...Imports CSV and Tab text files to tagger Auto Tagging and Re-naming using freedb online or other...
 
id3renamewmadecodemp3 wavvorbisogg wavtagburnermusicwave
NBFree MP3 to WMA Converter

Freeware by NBXSOFT
44 x 6005Kb downloads

...preset wma formats with different frequency, bitrate - auto rename wma file name...
 
wma convertermp3 converterconvert mp3mp3 wma
NBFree MP3 to WAV Converter

Freeware by NBXSOFT
79 x 2005Kb downloads

...GSM -change output wav frequency, channel, bits -auto rename wav file name...
 
mp3 wavmp3 converterconvert mp3wav converter
NBFree WMA to MP3 Converter

Freeware by NBXSOFT
222 x 6006Kb downloads

...change output mp3 frequency, bitrate, channel, quality - auto rename, skip or overwrite when file exists...
 
mp3 converterconvert wmawma mp3wma converter
Sleep Moon Xpress

Freeware by Reohix
30 x 12834Kb downloads

...Sleep Moon Xpress is a next-generation Automation Utility that takes computer automation to the highest...a lot options and features, such as Alarms, Automatic Shutdown, Remote Executions, Download & Upload Speed Detection...snap a picture with your mobile phone and rename it to "restart" and using Bluetooth send it...as it is received, Sleep Moon Xpress will automatically restart your computer. This will also work with...
 
automation toolsleep moon xpress softwaresleep moon xpress reohixreohix sleep moon xpressremote launchremote turn offremote control computerauto shutdown computer
PSYBEncrypter

Demo by Petsyb
26 x 1728Kb downloads

...folders for files , encrypt file names , automatically numerically rename files , shred individual files ,...CD/DVD , emailed with files at only 124k, autoclose if inactive and has a choice of three...
 
photographymoviephotosdecryptpasswordsecureimagefileencryptionvideopictureprivacysecurity
FineBrowser

Shareware by SoftInform
15 x 3415Kb downloads

...lock the important windows from accidental close and rename them with ease. The powerful bookmarks manager offers...
 
internet explorerinternet surfingblock pop-upbookmark managerpop-up killeralternative browsermultibrowser
Icon Searcher

Shareware by SoftPlus
47 x 13343Kb downloads

...location at once, added two save option:choice Overwrite, Auto Rename. * Support multilingual interface. * Support delete...
 
icon scanstyle iconiconsicon filesdelphidesktop iconcomputer iconwindows icondownload iconfree icondesktop shortcutsearcher iconicon searcher
RageWork

Shareware by Softrage
24 x 8318Kb downloads

...charset and line encoding, syntax highlight, line numbers, auto complete, tools, fast upload! *Fast, Multisource Search. The...
 
ftpmanagersearchsftpclientrageworkwordpdfbackupuncompessmanagementsoftragecompressexcelrtffile
Acez All Audio Converter

Shareware by AcezSoft Inc.
25 x 6480Kb downloads

...MP1, MPEG, WAV, OGG, WMA, VOX formats. 8. Auto rename, skip, or overwrite options for existing file....
 
audio converterwav converterogg convertermp3 converterwma converter
Acez MP3 WAV Converter

Shareware by AcezSoft Inc.
35 x 2202Kb downloads

...5. Build-in MP3, WAV audio files player. 6. Auto rename, skip, or overwrite options for existing file....
 
mp3 wav converterconvert mp3 wav
XYplorer

Shareware by Donald Lessau
37 x 3346Kb downloads

Free Vista Files award
...and an array of unique ways to efficiently automate frequently recurring tasks. XYplorer is a tool rather...
 
multi-tabbedexplorer replacementfile reportportableicon overlaysmp3file viewcolor filterpreviewdirectory printtime-stampingscriptingbatch renamefile findfile managerthumbnailsdual paneiconssearch templates
UniView

Shareware by Binary Soft, Inc.
31 x 829Kb downloads

...correct passwords are entered. 4.Support to convert and rename image files from one format to another in...batch. You can specify different convert and rename rules as you like, and UniView will do...everything automatically for you in one minute. 5.Provide 140+ different...that you can view a sequence of images automatically and please both the eye and the mind....6.Scroll, manual and auto zoom, rotate, thumbnail and full-screen mode features allow...
 
hpgjpegconvertppmimageanimaterenamehtmlsldpcdrladxfpsdpcxpgmmacgifwbmptgaalbumemfrgbicopngviewtiffencryptpltwmfpsppbmimgsgi
JukeBox Tools

Freeware by BirdCage Software
25 x 2012Kb downloads

...or Ogg also records inputs plus tags and renames files. Audio Editor- Record LP`s or Tapes,Visual audio...editor and auto file splitter that finds gaps and splits files.....Auto Rec - automated recorder for LP and Cassette ripping and or...
 
ripperjukeboxaspilamewmadecodeencodegrabberoggid3splittervorbistagrenamefreedbnormalizemusicmp3editburn