1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Sort by : ReleasedNameDownloadsAddedRatingRelevance
IQPEN

Shareware by IQPEN
34 x 11466Kb downloads

...and our knowledge management software, you can index audio or visual information by synchronizing it with your...
 
digital penknowledge management software
SuperEZ Wave Editor

Shareware by GoldMedia Co.Ltd.
14 x 10450Kb downloads

...SuperEZ Wave Editor is a visual music file editor designed for home studio recording...for people who are just getting started with audio editing. You can cut, copy and paste parts...filters, convert formats, adjust stereo channels and edit audio file information. The user-friendly and understandable interface is...WAV, etc. You have the option to record audio data from any system supported input (line-in, microphone,...fly and without creating temp files.
 
sound recorderpastefade outsound editoredit audioadd audio effectscopyrecord audioaudio editorrecord soundnoise reductionrecord musicecho effectsedit musiccutmusic editoredit soundaudio recorderadd echo
File Sender

Freeware by Qytec
95 x 1171Kb downloads

...all hard disks in a very effective and visual way), absolute download and upload statistics, sending messages,...
 
serverfilessendersharedaudiosharingclient
Salaat Time

Freeware by Salaat Time
141 x 14351Kb downloads

Free Vista Files award
...the prescribed times the Athan sounds and/or displays visual alerts. In addition you have a perpetual side-by-side...use the random feature. •Selection of different discreet visual alerts including balloon tips and tray flash. •Qiblah...and Ayaats. •Optional before and/or after reminders using audio and/or visual alerts. •Collect your Athans/Quran Recitations/Images in...
 
prayer timesmuslimathanhijri calendarathansislamprayer softwareazansqiblah direction
Digital TV 2050

Freeware by Endicosoft.com
671 x 2471Kb downloads

Free Vista Files award
...your PC. Extensive channels list. Sleek customizable interface Visual equalizer. News, entertainment , music, sports, shopping, languages,...
 
videodigitalchannelstelevisionradioaudiowatchglobalinternetplayercamerafreenetcamonlinemultimedia
Scirocco Take a Break

Freeware by Scirocco
28 x 1124Kb downloads

...complete customization of work, snooze and break times; visual and/or audio notifications; choice of displaying timer, starting...
 
breaktake breakrsitime managementcarpel-tunnel syndromerepetitive-stress injuries
...ActiveX control works great with ANY version of Visual Basic, and even allows you to send and...NCD video switchers allow computer controlled multiplexing of audio or vide signals from the RS232 serial port...
 
serialmotorindustrial automationlight dimmermotionportservovideors232digitale3cdeviceanologhome automationswitcherrelay driverrelay controller
Webcam Video Capture

Shareware by Webcam Simulator
354 x 6732Kb downloads

...a product, create a presentation with your own audio narration, make a voiceover tutorial, or walk through...
 
wm7trainingcapturetutorialscreen recordstreaming video capturewebcam recordscreenshotscreen recordertechsmithpresentationwebcam recorderscreencamscreen grabbercbtscreen capturerecord desktopsnag-itcamtasia
...Free Word Finder game ! This is an fun Hangman type Word Finder game for teaching children English vocabulary, Words and Spelling. The aim of the free spelling games is to...
 
finderchildrensspellingkidsgameswordsenglishfreeonlinevocabulary
...Word Dummy 4.0 is Graphical mode Kids Word Searches game application for teaching children English vocabulary through word building. The aim of the game is to create the given...
 
gamespuzzleswordkidssearches

Freeware by Quest Software
26 x 25468Kb downloads

...Spotlight on MySQL displays a complete visual representation of the MySQL database allowing you to...complex data sharing environments using flows, graphs and visual icons, and alerts you with an audio or...
 
mysqldiagnosticsperformancedatabase
EzVoice

Shareware by EzSoftTek.com
72 x 2195Kb downloads

...useful features such as remotely access your voicemail, visual and audio alert upon new calls, password protected...
 
mailvoice
Visual DV Time Stamp

Shareware by DTS8888
35 x 308Kb downloads

...files, the time codes get lost. By using Visual DV Time Stamp (vDTS), the time codes are...
 
stampvideodate
MailTalkX

Shareware by SoftByte Labs
15 x 3760Kb downloads

...MailTalkX is a spam filtering (Anti-Spam) and an email monitoring utility, it supports multiple mailboxes, allows you to check each mailbox automatically at specified intervals and can notify you...
 
spamcontrolcheckblockerjunksmtpmailboxreferrerlogfilteringnotificationmailxmessageforwardingmonitoringsoundmultiplemailtalkxemailunwanted
LinkAlertPC

Shareware by InBloom Products
13 x 4470Kb downloads

...The cost effective link monitor and alert notification system - LinkAlertPC (LAPC) can monitor basic TCP/IP, Internet HTTP based servers/pages/urls, Email, FTP, LAN connections, Printers, Services, Stocks and...
 
networkhttpsserviceftpfileemailmonitorlanibpfolderdiskinbloomtcplinkalertpcnotificationprinter
...Forms applications. Use the included authoring tool to visually design a rich chart template which can include...stunning animation effects, audio narration, text and image elements, links and tooltips,...and any other type of visual customization. Apply the chart template to any available...Rich Chart Builder: Use the authoring tool to visually design impressive chart templates instead of wasting your...
 
linerich mediagraphicsmultimediaplotsinteractive chartsspreadsheet importpresentationcolumnflash chartsdrill-down chartsgraphsswfdynamic chartschartinganimated charts
L-Lingo Tagalog (Filipino)

Demo by L-Ceps Ltd.
16 x 44032Kb downloads

...(Filipino) word and sentence of the program is visualized ... clear and easy to understand design of...
 
language learningpersonal trainerhome educationl-cepstagaloglanguage courselanguage schoollanguage programlanguage softwareasian languageslcepsonline language instruction
Visual Video Converter

Shareware by DanDans Digital Media
27 x 11743Kb downloads

...Beyond Simple Conversions FREE DOWNLOAD BUY NOW $34.95 Visual Video Converter can convert video files into video...clips, audio files and image files visually or capture video clips from your capture device....It supports almost all video, audio and image formats. This utility makes a quality...who need powers that go beyond simple conversions. Visual Video Converter also supports splitting video files, extracting...
 
extract audiovideo splitterextract imagevideo convertervideo joiner
Free Vista Files award
...allowing full control over a wide range of audio and video settings from stunning visual FX to...6+ (SWF format) files. - Converts Video and Audio from Virtually Any Format: Windows Media (AVI, WMV,...a sequence of static images and an optional audio file into a video....
 
divxconvert video flashflvaspnet scriptsh264development toolsaspnet componentsdigital videocodecsvideo sdkflash generatormultimedia toolsflash conversion
Liquib

Shareware by Whizical.com
51 x 6978Kb downloads

...(or toy) that attempts to translate mathematics into visual imagery. Manipulation Tools and Effects can be manually...can optionally be centered to maximize symmetries. The visual display can be accompanied by music from the...
 
scriptingmidivideodrostemaskingliquid imagemarbled paperbubbleswavesdropsspray