1 2 3 4 5 6 7 8 9 ... 170 171 172 173 174 175 176 177 178 179

Sort by : ReleasedNameDownloadsAddedRatingRelevance
AVI to MPEG4

Freeware by AVItoMPEG4.org
4 x 5049Kb downloads

...If you need to transcode your AVI videos to MPEG-4 format, this 100% free software can help you. Using it, it is possible to easy and quickly get MPEG-...
 
avi mpeg-4avi mp4avi mpeg4video mpeg4
TraceZapper Audio Converter Frist

Freeware by TraceZapper.com
2 x 4264Kb downloads

...iPod Audio Converter is an easy to use tool to convert audio files to iPod Audio Format and also to another various audio formats,also can extract audio from video...
 
ripcdawavmodadxalacoggmp2movflacstereomp1dataacipodmidimpcformatdual channelsac3spxmpegofrtracksmo3mpgcd-rrw drivesmp3encoderswmvasfttaapemp4audioconverterwma
DX Audio Converter Extractor Max

Freeware by DVDBackupXpress.com
2 x 4597Kb downloads

...Audio Converter Extractor Max is an easy to use tool to convert audio files to various audio formats and extract audio from video files to various audio formats. The program...
 
ofrmaxmp4modmp1midioggtracksconvertspxmp2adxextractoraudiompcvideoconverterwavmpegmp3formatscdaflacasfwmawmvalacdatapettampgmovac3mo3ripaac
Aiseesoft DVD Converter Suite Platinum

Shareware by Aiseesoft Studio
2 x 79462Kb downloads

...Aiseesoft DVD Converter Suite Platinum contains DVD Ripper, Total Video Converter, DVD Creator, and iPhone transfer Platinum. It can rip any home DVD disc and convert popular video/audio files...
 
iphone transferconvert dvdrip dvddvd converterdvd creatorvideo convertor
MP4 to AVI

Freeware by MP4 to AVI Software
2 x 5105Kb downloads

...If you need to transcode your MP4 videos to AVI format, this cost-free program can help you. Using it, you are enabled to easy and quickly get AVI fomat...
 
mpeg4 avimp4 videomp4 avimp4 converter
AnyMP4 DVD Ripper

Shareware by AnyMP4 Studio
2 x 24883Kb downloads

...AnyMP4 DVD Ripper, the most powerful and easy-to-use DVD Converter, which can help you to convert and rip any DVD movie to the most popular video and audio...
 
dvd ripperconvert dvddvd videorip dvd
Aiseesoft DVD Software Toolkit Platinum

Shareware by Aiseesoft Studio
2 x 87449Kb downloads

...Aiseesoft DVD Software Toolkit Platinum can rip any DVD disc and convert popular video/audio files to any video and audio format, burn any video to DVD disc, DVD folder...
 
dvd rip softwarerip dvdvideo conversion softwaredvd creatordvd ripperiphone transferiphone ringtone makerdvd software
Higosoft DVD Ripper

Shareware by Higosoft
2 x 19748Kb downloads

...Hey, do you want to play DVD files on iPad, Samsung Galaxy S2 or Kindle Fire? Do you know how to Import DVD video to multimedia device and software? Higosoft...
 
import dvd filesdvd ripperdvd ripper for widnows7rip dvdconvert dvd video
Flash Video Studio

Shareware by IncrediTools
3 x 10547Kb downloads

...Flash Video Studio is an easy and powerful tool to convert most video files into Macromedia Flash SWF and FLV. It supports the following video formats: AVI, DIVX, MPG, WMV,...
 
flash toolsconvert videoflvvideo flashmacromedia flashflash videoconvert video flash
Most AVI Converter

Freeware by mostconverter.com
1 x 1718Kb downloads

...asf, divx, xvid, mov, mkv, mpeg, swf and wmv video files. and you can also extract audio...
 
avi flvavi mkvavi divxavi mpegavi wmvavi swfavi xvidavi mov
MPEG to AVI Encoder

Freeware by MPEGtoAVI.net
2 x 5154Kb downloads

...If you want to convert your MPEG videos to AVI format, this 100% free application can fulfil your needs. Using it, it is possible to easy and quickly get AVI...
 
mpeg convertermpeg avimpg avi
Video to Picture Image Converter

Shareware by Hoo Technologies
4 x 10984Kb downloads

...Video to Picture Image Converter converts video to picture or image sequence frame-by-frame. The software supports 80 video formats including 3GP, 3GP2, ASF, DAT, DivX, DVR-MS, EVO,...
 
take picture from videovideo picturecapture picture from videoget picture from videovideo imagevideo picture converter
Axara Video Converter 12

Shareware by AxaraSoft.com
1 x 18973Kb downloads

...It is the most professional tool created for converting various video files and ripping DVD into all key video formats for PC, mobile cells (iPhone, Motorola, Nokia, Samsung, Sony Ericsson,...
 
convert video filesvideo converterconvert videosvideo files converter
...Convert video and audio files, rip DVDs, download online video, record from screen and webcam. Do it for free. This software is a powerful multimedia converter and editor, that is...
 
free media convertervideo converteraudio converterscreen recorderdvd ripperyoutube downloader
Sothink Web Video Downloader

Shareware by Sothinkmedia Germany
4 x 13135Kb downloads

...Sothink Web Video Downloader is your must-have YouTube downloader that can download videos in different formats and save them to desktop and portables. It is smart and very easy...
 
flv downloaderflash video downloaderyoutube video downloaderyoutube downloadyoutube downloader
WMA MP3 Changer

Freeware by Wma-to-Mp3
1 x 12424Kb downloads

...want to extract audio track from video in WMV or ASF format. Then WMA MP3 Changer is...
 
wmv mp3wma mp3wmv mp3 converterwma mp3 converterfree wma mp3convert wma mp3free wma mp3 converter
Cute Video Cutter Free

Freeware by video converter
1 x 1718Kb downloads

...Cute Video Cutter Free Version a free easy-to-use video utility to help you to cut and split your video files into small size.It can cut large video...
 
video cuttercut movcut wmvcut mpgcut mp4cut flvcut avicut video
AnyMP4 iPhone Ringtone Maker

Shareware by AnyMP4 Studio
1 x 31129Kb downloads

...AnyMP4 iPhone Ringtone Maker is the powerful iPhone M4R ringtone making software, it can help users to create the unique iPhone ringtone with source DVD, video and audio files and...
 
iphone m4r ringtone makermake iphone ringtoneiphone ringtone makerconvert video iphone ringtone
RFTP Media Player Max

Freeware by RobustFTP.com
3 x 17290Kb downloads

...3g2. 2) Supported Input Video Formats: .wmv , asf , avi , mpg , mp2 , mpe...
 
ogmvideo dvdsmp4m4am4vmovwmasmartwmvoggmkadvd-drivehdmovmp3dvd-videomaxflvdiscsmpevideo-cd3g2formats3gppasfplayeraudiocodecsmpegmp2aacwavmpg
Aiseesoft 3D Converter

Shareware by Aiseesoft Studio
2 x 24576Kb downloads

...Aiseesoft 3D Converter is for converting SD/HD videos to 3D videos including Anaglyph 3D, Side by Side 3D, and Top and Bottom 3D. The output 3D video files can...
 
convertconvertervideo converter