1 2 3 4 5 6 7 8

Sort by : ReleasedNameDownloadsAddedRatingRelevance
SteelSoftScreenShot

Shareware by SteelSoft
2 x 457Kb downloads

...Powerful tool for quick screen capturing, annotation. Take a photo of your computer screen, including long webpages,online video. Enhance your image with arrows, text, and effects in the steelsoft...
 
screenscreenshotcapturesteelsoft
Traditional medicine books dictionary

Shareware by Eastsoft Team
4 x 15564Kb downloads

...Traditional medicine books dictionary has collected more than 150 ancient medicine books` brief introduction in China, Korea, Japan, Vietnam, etc. It has 8 classified catalogues, whose names are translated according...
 
eastsoftmedicine booksdictionaries
Delphi to C++ Builder

Shareware by Thinker Software
30 x 547Kb downloads

...how to convert Delphi code segment to C++Builder. Delphi to C++ Builder can`t substitute for your handcraft modification completely, but can save 80% time for you! Improvements of...
 
builderdevelopprogramcodedelphi
BOM4CAD 2007 - Automatic numbering

Shareware by STEFISKO.com
1 x 322Kb downloads

...drawing with number annotations. It can create number annotations build with leader entity and unique sequence number...
 
sequence numberbom4cadautomatic numberingautocadannotationleader
iWiiBoard Whiteboard Software

Shareware by iWiiBoard
16 x 7112Kb downloads

...them fascinated, no matter what the topic! Every annotation that you make using iWiiBoard can be saved,...something on your computer screen, but also include annotations and markups Wanted a neat way to call...Complete your setup with the best Wiimote Whiteboard annotation software that we have found. This software has...
 
wii whiteboard softwareiwiiboardwiimote whiteboardwiimote whiteboard softwarewii remote whiteboard
BOM4CAD 2010 - Automatic numbering

Shareware by STEFISKO.com
2 x 321Kb downloads

...drawing with number annotations. It can create number annotations build with leader entity and unique sequence number...
 
annotationautomatic numberingbom4cadleaderautocadsequence number
jPDFNotes Java PDF Notes Bean

Shareware by Qoppa Software
1 x 27514Kb downloads

...files. * Easy navigation with thumbnail, bookmark and annotation views. * Fill and save PDF forms (acroforms,...xfa non-dynamic). * Annotation toolbar to let your users insert notes and...
 
javapdfnotesreviewannotatormarkuplibraryfillcommentsviewerannotateeditorbean
Colasoft Ping Tool

Freeware by Colasoft Co., Ltd.
28 x 4790Kb downloads

...item in the graph chart and popup an annotation contains the domain name and response time when...
 
internetethernet2000sniffercapturemacintranettelnetwindowsnetworkmonitorpingsecurity
NoteMaker

Shareware by Fox Magic Software
2 x 2933Kb downloads

...Video Editor to annotate AVI,MPEG,WMV videos by adding callouts, images, lines, text, outlines, sounds, narrations, effects and export videos as AVI,WMV,SWF/FLV (Adobe Flash) files. Many...
 
swfvideoannotationmpegflvcalloutsnoteseditorsoundswmvnarrations
eXPert PDF Reader

Freeware by Visagesoft
72 x 5998Kb downloads

Free Vista Files award
...document outlines, insert rubber stamps and modify any annotation that has been created from eXPert PDF or...
 
printpdfreadertoolviewsaveannotate
SPX Studio

Shareware by Moodysoft Inc.
13 x 1757Kb downloads

Free Vista Files award
...Don`t just make screenshots. Design them. Make intelligent screenshots now; explain your ideas. Add sticky notes, text, highlights, callouts, shapes, images, highlightes. Keep...
 
spxtrainingwebcamscrollemail imageplaybackcapture screenannotatemarketinggraphicannotationnotesscreen captureprint screenscreenshotcapturingrecordwatermarkgrabberzoomtimerstampscreen grab
SL Image Components SDK

Demo by Image Components
2 x 32728Kb downloads

...Image Components for Silverlight, is a comprehensive Silverlight Imaging SDK. It allows users to read and edit the most common image file types, and convert between them.It also allows...
 
image editorbarcode readerimage thumbnailsimage ocrimage viewerimage annotations
Advanced Pathway Painter

Freeware by GSA
30 x 5145Kb downloads

Free Vista Files award
...This freeware program visualizes pathways (KEGG, BioCarta, GenMAPP, ...). The user has the possibility to display any kind of quantitative data from gene and protein experiments directly within the pathways (colours...
 
genmappbioinformaticsncbibiocartamicroarrayproteinbiologykegggeneanalysispathwayaffymetrixexperimentsequenceanalyseannotationbioscience
CaptureIt

Shareware by CaptureIt Tech
6 x 2675Kb downloads

...CaptureIt is a powerful, flexible and easy-to-use screen capture software. It allows you to capture anything on the screen including windows, objects, full screen, rectangle-selected regions, fix...
 
capture scrolling windowcapture windowsscreen capture toolsscreen capture software
...Corporate Communication Server for Your Company: In today`s business world, effective communication is key. Instant Collaborator gives your business the resources it needs to conduct Interactive Web Conferencing, Online...
 
online support softwareonline training softwarecollaboration softwarecommunication softwareonline meeting server
Screenshot Studio

Shareware by SmartSoft Team
18 x 829Kb downloads

Free Vista Files award
...Powerful tool for quick screen capturing, annotation and screenshots sharing. Take screenshots (whole window, part...from standard, Direct3D and OpenGL modes - Powerful Annotation System: you will need just a couple of...
 
publish screenshotedit screenshotfree image uploadscapture screenbugs documentationbugtrackingtake screenshot

Shareware by llionsoft
13 x 1090Kb downloads

...ActiveX Server for create Portable Document Format (PDF) files on fly. Easy way for create PDF files from your application Main features: Real hDC; Acroforms (buttons, radiobuttons, checkboxes, comboboxes, text...
 
generationactivexpdfcreate
WPF Image Components SDK

Demo by Image Components
2 x 23192Kb downloads

...Image Components for WPF, is a comprehensive Windows Presentation Foundation Imaging SDK. It allows users to read and edit the most common image file types, and convert between them. It...
 
image scanningimage ocrimage thumbnailsimage annotationsimage captureimage viewerimage editorbarcode reader
SCREEN2SWF

Shareware by Stepok.com
4 x 1090Kb downloads

...be fast enough. Edit Add text, image and annotation into your recorded video. Add zoom in, focus,...
 
screen recordingscreen recorderrecord screen
Presentation Marker

Shareware by GoldGingko
2 x 3514Kb downloads

...presentation when there is a need to make annotation on screen for better illustration. If you give...
 
magnifier tooldesktop drawget audience attentionscreen drawdraw screendesktop drawingdraw desktopteacher softwarescreen zoommagnifier screenpresentation softwarehighlight screendesktop zoomtrain softwarezoom toolscreen drawing