1 2 3 4 5 6 7 8

Sort by : ReleasedNameDownloadsAddedRatingRelevance
EControl Syntax Editor

Freeware by EControl Ltd.
92 x 952Kb downloads

...Powerful text editor with syntax highlighting. This editor is built using EControl Syntax Editor SDK. The...
 
aspspell checkingeditfoldinganalysishighlightingsyntaxhtmlxmlformateditorcontrolplain textkeymappingcode editorphplexer
KaraFun Karaoke Player

Freeware by RECISIO
813 x 4945Kb downloads

...KAR, CDG+MP3 and LRC files replay, Direct 3D animation engine, playlist management, Fullscreen or windowed display, multi-monitor...support. Some of editor features: Realtime rendering, library management, effects and events...is based on a powerful and evolutive 3D animation engine and contains its own editor. Even if...
 
freesongskokeditorkfnvoice recordingpitchfilesplayermp3karaoketempovocal removercdg
Tile Studio

Freeware by Wiering Software
53 x 1685Kb downloads

...of tile-based games. The application contains a bitmap editor for creating tiles and sprites and a map...can program Tile Studio to output your maps, animation sequences, bitmaps, palettes, etc. in any format and...
 
sprite editortile editorgraphicsmap editorgame programming
Multis

Freeware by Chrystal Softworks
25 x 1018Kb downloads

...Hi-End Multi - Tetris. Tetris/Tritis/Pentis/etc... games with Clean/Trash/Pattens modes. Full customizable user interface and huge game play options. Total free. For addons, upgrades and help,...
 
randistritismultispatternsmaxishexiskiddisquadristetriscraizispentisfantis
Pivot Stickfigure Animator

Freeware by Peter Bone
149 x 937Kb downloads

...software, that allows you to create stick figure animations easily and without any artistic skills. You can...stick figure and easily create a chain of animation frames that can be previewed as you go....stick figures using an easy to use visual editor that lets you assemble objects out of lines...and circles. In addition, you can optionally set animation size, speed and more. The result can be...saved as animated GIF file.
 
freeware
PaintStar

Freeware by Zhenzhou Wang
88 x 2640Kb downloads

...another and generate output in a form of gif animation or image file sequence. Gradient Fill tools...
 
freewaremorphlayerpathscreen captureimage editor
GFX Alchemy

Shareware by GFXAlchemy.Com
45 x 8469Kb downloads

Free Vista Files award
...Powerful all-in-one solution for image editing, conversion, and viewing of 140+ image formats. Advanced features include 60+ special effects, filters, and color adjustments; batch format conversion; comprehensive annotations;...
 
rotategraphicsacquiremirrorphotosspecial effectseditorslideshowpaintconverterthumbnailerresizeprintanimationfliptwainzoombatchscreen captureclipartvieweroptimizecropannotate
CDH Image Explorer Pro

Shareware by CDH Productions
30 x 21002Kb downloads

...batch format conversion, advanced thumbnailing and thumbnail browser, GIF animation creation, GIF to video (AVI, MPG, WMV)...and video (AVI, MPG) to GIF conversion, video editing, video creation / decompiling, video...
 
textprintzoomtwainshapeconverterrotatemirrorbatchclipartthumbnailingresizeeditorcropacquirevideooptimizeviewerflipslideshowprocessingphotoscapturegraphicsanimationspecial paint effectsplayer
Advanced GIF Animator

Shareware by Creabit
73 x 5464Kb downloads

...Advanced GIF Animator is a powerful tool for creating animated...even movies. You can use the built-in image editor or any stand-alone graphics editor to create image...files that will be assembled into a GIF animation. Duplication, mergers, cropping, re-sizing, rotation and frame...flipping; capability to create animated GIF files using sets of BMP, JPEG, ICO, and...
 
jpegpicturepaintbuttonanimationwebgraphicgifanimatorinternetimagebannermakerdesign
Active GIF Creator

Shareware by Image Tools Group
63 x 16881Kb downloads

Free Vista Files award
...With Image Tools Group Active GIF Creator you can create fabulous animated GIF images...of images; - edits images using internal image editor or script editor; - duplicates, merges, crops, resizes,...flips frames; - defines GIF- files global parameters: GIF size, logical screen size, background color index, number...button images; - uses image collections; - creates animation scripts; - optimizes size of GIF- files; -...
 
button creatoreasy gif animationbannersimage effectsweb designsharewarepresentationeasy buttonpublishingcommand linebatch modegif animatorwebmaster toolsanimated gif
Sothink SWF Quicker

Shareware by SourceTec Software
12 x 19692Kb downloads

...Sothink SWF Quicker is a powerful Flash Editor to edit SWF directly or export flash and...of Flash by ActionScript (1) An intelligent ActionScript Editor which supports Syntax Highlighting, Auto Completion and Dynamic...Prompt is embedded in the animation software. (2) Able to design interactive game with...
 
flash creatorflash makeranimation makerswf editorflash builderhtml5 animation makeranimation creatorbuild flashmake flashflash editorcreate flashmake animationmake html5 animationflash software
Antenna Web Design Studio

Shareware by Stormdance
26 x 7637Kb downloads

...stunning! Antenna is a professional WYSIWYG web page editor designed for creative people. It`s fun, easy to...
 
antennaweb design softwareweb pagedesignercreationweb page editorweb site creationbuilderhtmlwebsitepage makerweb site builderwysiwygcreator
EximiousSoft GIF Creator

Shareware by EximiousSoft
206 x 9064Kb downloads

Free Vista Files award
...EximiousSoft GIF Creator is a kind of powerful,rapid and visual...good effects,it can help you make out amazing animations or banners within short time. EximiousSoft GIF Creator...delete this area according to your needs. EximiousSoft Gif Creator has strong support to vector graphics. You...rectangle, ellipse and other geometric shapes. Besides, EximiousSoft GIF Creator can produce many texts or symbols with...strong 3d vision effects.
 
gif toolsanimated gif editorgif animationsimage editingimagesanimation makersoftwarecreate bannergif imagesanimated gifscreate gifgif creatorgif animatoranimated gif creatorgif converter
CoffeeCup Animation Studio

Shareware by CoffeeCup Software
54 x 4608Kb downloads

Free Vista Files award
...With Animation Studio, you can create clever animated graphics that...turn practically any image you own into an animation - but it`s the support for our very...you did it. There`s even a built-in image editor that features drawing and selection tools to put...panel makes advanced editing tasks unbelievably simple. Using Animation Studio is a dream come true. Now you...
 
web image studiobmpthumbnailanimationjpgeditorbitmapgifimportanimatewifexport
IconX

Shareware by Stardock Systems
75 x 1566Kb downloads

...$9.95, which adds additional features such as enabling animation and saving changes between start-ups. The enhanced version...
 
desktopcustomizationstardockwindowblindsanimateicon toolsicons
Magic ASCII Studio

Shareware by XoYo Software
74 x 1799Kb downloads

...Words, ASCII Art Photos and even ASCII Art Animations easily by using Magic ASCII Studio. Magic ASCII...Studio: - Make ASCII Art Word(s), Photos and Animations - Visual ASCII Art making process - .BMP,...image you want to process - Built-In Image Editor for processing the image quickly - Add-in(s) support...
 
ascii art animationbmphtmlconvert image ascii artascii art picturetext imagemagic ascii studiocolor-coded text charactersrtfxoyosoftweb animationascii art wordweb photo
GentleDraw

Shareware by GentleGames
34 x 1207Kb downloads

...You can easily adjust color, texture, borders and animation settings. GentleDraw can save animations as animated GIF...files. The program includes 3D models borders editor and animation routes trace editor. GentleDraw is a...
 
software for animationbmphighpagedesignerrotationplacementsizequalitysoftware animationwebanimatedpicturegif animation softwaretexture
Power Render

Demo by Egerter Software
18 x 32478Kb downloads

...from companies such as Logitech and ActLabs, character animation using skinning, tweening, or keyframing. Power Render 6...support for characters is provided along with an editor for adjusting skeletal geometry and physics properties....
 
game developmentgraphicsprogrammingengine
EControl Syntax Editor SDK

Shareware by EControl Ltd.
30 x 7381Kb downloads

...Powerful text editor control with syntax highlighting. This editor is built using EControl Syntax Editor SDK. The...DFM text format. Features: - Delphi 2007 like editor - Fast working even with huge files (several...100% customizable lexer (syntactical analyzer). Comfortable visual lexer editor - Nested lexers highlighting.Combining several lexers in one...folding - Stack-based markers - Unlimited bookmarks - Animation - Normal, column-oriented and...
 
editorcppa2lfoldingaspxmllexercontroltexthtmldfmcblhighlightingspell checkingkeymappingphpformatsyntaxanalysis
CodedColor PhotoStudio Pro

Shareware by 1STEIN Corp.
25 x 58000Kb downloads

...CodedColor PhotoStudio by 1STEIN is a powerful and versatile photo organizer and image editing software for digital camera users. Features include photo editing & printing, web album galleries, slide shows, photo...
 
acdseealbumexifimageconversionthumbsmultimediagraphicsbalancetifphotogpseditorpanoramaprintpublishbmpbatchpdfviewerdtpjpgorganizegifjpegflashrawcameraiptcarchivepicasawmfcatalog