1 2 3 4 5 6 7 8 9 10

Sort by : ReleasedNameDownloadsAddedRatingRelevance
MyViewPad

Freeware by fCoder Group, Inc.
92 x 2580Kb downloads

Free Vista Files award
...and nonstandard formatting, as well as multi-page and animated files. All of this was tested over and...
 
total commander pluginimage viewergraphics viewerphoto viewertotalcommander plugin
My Pictures 3D Screensaver

Freeware by VicMan Software
147 x 4962Kb downloads

...beautiful virtual gallery exhibiting favorite shots from your photo album. Besides, it can function as an animated...3D photo gallery screensaver - surely the most fun alternative...be specified to make your walk through the photo gallery as much comfortable as possible. In the...freely inside the virtual space and enjoy your photographic masterpieces in the tasteful surroundings of picturesque galleries....
 
view photosfree movephoto viewingvirtual spacescreen saverfree screensaverimage galleryview pictures
3DBrowser Light Edition

Shareware by Mootools
105 x 51078Kb downloads

Free Vista Files award
...files the way you want: View your whole photos library thanks to the multi-folders browsing capabilities. A...your memories Slides show feature: Display your favorites photos or 3D meshes in full screen. Slides appear...
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
Balthers Graphic Groove Box

Freeware by Balther
41 x 20368Kb downloads

...key and MIDI control with interactive real time animated Effects. No installation required except of the Quick...3D text. Edit and real-time manipulation. 4. One animated free mask effect in the form of a...
 
animationreal timemidivideodigital art toolmoving visualsinteractivesoftwareeffect
VCW VicMan`s Photo Editor

Freeware by VicMan Software
142 x 5010Kb downloads

...Now with all PRO features. With this free easy-to-use image editor, you can turn your snapshots into works of art, as well as draw your own images using...
 
graphicsresizebrushphoto effectfish eyephoto suittextfree photo editortwirlimprove imagedrawedit photophoto filteredit imagecorrect imagefree image editorcroppencilcorrect color
...executable file (EXE), screen saver (SCR), Flash (SWF), animated gif (GIF), video (AVI) or to present it...
 
educational materialseducational gamese-bookcbtinteractive catalogmaxmediae-zinedigital albumscreensaversbannercd-cardmultimedia presentationsinteractive kioskmultimedia authoringslide-show
PixMatrix

Freeware by Tufala LLC
25 x 5609Kb downloads

...PixMatrix allows you to quickly create web photo albums and web pages. This software is designed...not require HTML knowledge. You can create Java animated web pages featuring your digital photos with a...
 
free web albumfree image galleryfree photo sharingfree web photo albumfree photo album softwaredigital images

Freeware by Blender Foundation
39 x 6500Kb downloads

Free Vista Files award
...helps recreate the in-store experience in real-time. Combine animated rich environments with 3D product modeling, to create...
 
freeware
...Maker is a Flash album creator to make animated photo slide shows with SWF file as the output...format. It transforms digital photo collection to Macromedia Flash file format (SWF) which...DVD disc playable on computer and save original photos on CD/DVD disc. It supports file uploading, selecting...show software allows you to add nice looking animated slide shows to your website in no time!...
 
swf converterflashswf toolonline slide showphoto swfflash slidephoto slideshow swfswf slideshowonline slideshowflash slideshowphoto flash

Demo by fCoder
11 x 2795Kb downloads

Free Vista Files award
...6 color correction methods or any of 4 photo enhancement effects. And remember that all these edits...colors transparent or remove transparency. You can make animated or interlaced gif files as well. Among other...
 
filethumbnailgraphicswmfgifdigitalviewerconverterpcximagesformatbmptiffbatchjpeg
InAlbum

Shareware by IncrediTools
3 x 98611Kb downloads

...easy to use software to turn your digital photos and videos into stunning photo album slideshows or...let you mix and match background animations, buttons, photo frames and transition effects. Then you can decorate...templates which are uniquely designed to present multiple photos at a time. Furthermore, you can also import...Flash Movie, animated GIF, PNG and WMF, or make fun with...PC. Build executable files, screensavers and wallpapers.
 
photo albumdigital photoonline albumshowpresentationanimationflashslidegalleryincreditoolsgraphicsslideshowinalbum
FaceMorpher Lite

Freeware by FaceMorpher.com
119 x 5234Kb downloads

Free Vista Files award
...with your favorite video editing tool, create an animated GIF or a Flash movie to publish it...
 
morphing softwarephotoautomatical toolfacesimagesanimation
Alive! Jigsaw Producer

Shareware by Yavsoft
12 x 1172Kb downloads

...pictures and photos. Puzzles will have a customizable animated interface with panel color selection. Be the computer...
 
utilitytoolvideocreatefilmjpgphotospicturesdesigncreationgamewmfproducerjigsawpuzzle
ArtixMedia Menu Studio [Christmas Ed.]

Shareware by ArtixMedia.com
12 x 7274Kb downloads

...ArtixMedia Menu Studio [Christmas Edition] is multimedia CD creation tool, with a wide variety of options intended for special CD-gifts making. Using the program you may create for your...
 
fascinatingdeveloperstunninggiftpresentationsjoyfulfriendsinteractivelearningautorunartixburncdsbusinesscdromapplicationschristmascoursesquicklyeasilymultimediacd-card
InAlbum Deluxe Edition

Shareware by IncrediTools
17 x 19157Kb downloads

...easy to use software to turn your digital photos into stunning photo album slideshows/DVD movie. Start with...let you mix and match background animations, buttons, photo frames and transition effects. Then you can decorate...your show with animated clipart, speech bubbles, sounds, MP3 music and voices....PC. Build executable files, screensavers and wallpapers. Print photos in various size and format: standard, jumbo, full...
 
increditoolsgraphicsdigital photoanimationphoto albumflashgalleryonline albuminalbumslideshow
Fun Morph

Shareware by ZeallSoft
69 x 1817Kb downloads

...Fun Morph is funny and easy to use photo morphing and warping software. Morph and warp face...including avi video, web page, email, greeting cards, animated gif, picture sequence and etc. Let your imagination...
 
moviesoftwareanimated gifgraphicfunnypictureflashphoto morphfaceprogramswfhumorvideomagicjokeanimation toolsweb designwarpingmorphingimage
NoLimits Rollercoaster Simulation

Shareware by Mad Data
83 x 15564Kb downloads

Free Vista Files award
...dynamics of a real roller coaster, with its animated objects, dynamic 3D shadows, and detailed rendering of...
 
roller coaster simulationrollercoasterroller coaster simulator
...scintillation, extinction, refraction, and precession in point source, photo plate and spotlight display styles; along with the...With complete incorporation of Microsoft Agent speech technology, animated characters guide you painlessly through the pronunciation of...
 
sky simulatorskymapstarsorreryplanetsstarmapgalaxiesplanetariumencyclopediaatlascometsmultimediaasteroidsdsosastronomydictionary
Amara Photo Animation Software

Shareware by Amara Software
42 x 4332Kb downloads

Free Vista Files award
...Amara Photo Animation Software creates stunning virtual tours through still...photos for on your website. With Amara Photo Animation Software you can build a slideshow of...for instance. Another option is to turn panorama photos into a 360-degree panning view. Features include among...
 
animatedpicturesken burnsflashanimationsslide showanimatormakeramaraslideshow
Amaze

Shareware by Xequte Software
13 x 2557Kb downloads

...Amaze Photo and Multimedia Screen Saver is designed to display...saver, Support for all common image formats including animated GIFs, JPEGs, PNG, etc., Support for background music...
 
slide show screensaverimage screen saverpicture screensavermultimedia screensaverphoto screen savermultimedia screen saverpicture screen saverphoto screensaverimage screensaverslide show screen saver