1

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Free Vista Files award
...of essential self knowledge, a knowledge that makes all other knowledge and activities pale in comparison. Brighten...of self knowledge and gain a world perspective usually reserved for ascetics and saints....
 
srila prabhupadakrishnacomgaurangahare krishna maha mantra
...which the scholar wants to ascertain is - Allah is both Impersonal and Personal. The work consists...quotations vivid instances, irrefutable examples has proved that Allah is both - Corporeal and Incorporeal. The talented...systematic manner and tried to prove the great saints conclusion. But in the Muslim world most of...religious scholars are not ready to recognize that Allah has any form. Whatever the opinion, it has...
 
srila prabhupadagaurangapure bhaktikrishnacom
Queen Hynde

Shareware by Clarkscript
14 x 6079Kb downloads

...and romance set in the early Scotland of saints and swordsmen. A young Scottish queen must rule,...and song, and without doubt many characters are historically authentic.The remnants of Beregonium, first palace of the...
 
benderlochargyllqueen hyndeberegoniumjames hoggscottishverse
Christian Virtual Hymnal

Shareware by MusicEase Software
36 x 1786Kb downloads

Free Vista Files award
...is something you must have. It contains almost all the public domain songs in these and will...hymnals. No need to worry about copyrights as all hymns and arrangements are public domain (No CCLI...chord frames or none; - 1, 2, 3, all or no verses under the notes or after...
 
churchhymnsbaptist hymnalcelebration hymnalworshipchristianmusic
RamCal

Shareware by Remy Pialat
21 x 972Kb downloads

...a date in one of these calendars to automatically see the conversion in the other calendars and...the beginning of the gregorian calendar; tell the saints for each day (current and traditional dates); tell...
 
monthsrepublicanjulianstyledayssaintdateshijrijewishyearsfrenchcalendarsramcalperpetual calendarsaintsgregorianmuslimromanhebrewmoslemhebraicfeastsuniversal calendarislamic
Free Vista Files award
...the Old Testament, Religious Words and Phrases, Sacraments, Saints and Women in the Bible....
 
educational softwarespellingnon-violentreligionsunday schoolsgameshangmanbible
Halloween Pumpkins

Freeware by Novel Games Limited
13 x 295Kb downloads

...up before the time runs out so that all of them can be expelled from the graveyard....each side of a row. Move your mouse vertically to select a row, then click to place...at the top right corner. A bone will allow you to remove the whole row of pumpkins...the same time, while the skull will remove all pumpkins of the same type. Take notice of...
 
trick treatpumpkingravebonefestival gamesspirittetris style gamesskulljack-o-lanternaction gamespumpkinspuzzle gamesall saints dayarcade gamesgraveyardhalloweenaction puzzle gameshalloween pumpkinswitch
American Football Predictor

Demo by NeuralBet
4 x 15235Kb downloads

...neural networks this revolutionary software will predict American Football game results with great accuracy! If you want...and free tips and start using this amazing football handicapping software! Features: - Incredibly simple to use,...enter any data! and no need for a football helmet! - Uses Advanced neural networks with proprietary...for NFL and NCAAF games ! - Software automatically analyzes a wide range of variables (teams, players,...
 
pickspremierhorsepredictionmlbnflbaseballsoftwaregamblingbetdaqsportamericanncaafbettingtipsnhlracingbasketballpunterforecastbetfairnbasoccercflfootballice hockeygreyhoundsleaguehandicapping
Halloween Night Animated Wallpaper

Shareware by EleFun Multimedia
5 x 3599Kb downloads

..."Halloween Night" - Animated Desktop Wallpaper by EleFun Multimedia. Do you enjoy your desktop...wallpaper? Just have a look at Animated Desktop Wallpaper "Halloween Night"! Halloween is known and loved today...origins go back centuries to the enactment of All Saints` Day, a Christian holiday. Along the way,...a Celtic festival celebrating the start of winter.
 
animatedwallpaperhalloweendesktoptheme
Halloween Adventure Screensaver

Freeware by FullScreensavers.com
15 x 6141Kb downloads

...the best our screensavers devoted to famous holiday. Halloween is the oldest holiday in the world. Celtic...tradition of spirit celebration and Christian saints worship are mixed in this holiday. All sorts...shunned by men and appear before them in all its glory. On this night all the evil...the sundown. Ominous shadows appear in ancient castles, all sides are heard strange sounds, and a quiet...night no longer seems so safe as usual.
 
halloween screensaverfree screensaverholidaydownload screensaver
PravIcon.com orthodox icon guide

Freeware by PravIcon.com
3 x 5816Kb downloads

...English and Russian interface that does not need installation and can work with or without an Internet...get texts of prayers. The website will be automatically translated from Russian into English if English is...
 
orthodox iconspravoslavnye ikonyfree iconsrussian iconsdownload icons
...dusting gold from the clouds sunrise. That potion all used to dispel the Land that there were...
 
screensavershalloweentimepiecetimelinehelloweenboilerwitchday all saintsskyline timeclockfirebroomwatch
PravIcon.com orthodox icon guide

Freeware by Acritum
5 x 6621Kb downloads

...English and Russian interface that does not need installation and can work with or without an Internet...get texts of prayers. The website will be automatically translated from Russian into English if English is...
 
orthodox iconsdownload iconspravoslavnye ikonyfree iconsrussian icons
Pobosoft Flash ECard Maker

Shareware by Pobosoft, Inc
3 x 9082Kb downloads

...a CD so that it can be played automatically once CD is inserted, even on friends` computers....soccer, etc. 3. Funny. Graduation, back to school, All Saints` Day. 4. Entertainment. Music, vacation, sea beach,...
 
photo slideshowslideshow greeting card makerslideshow ecardphoto ecard makerflash ecard maker
Halloween Night Riddle

Freeware by GameHitZone.com
5 x 20753Kb downloads

...3D logic/puzzle board game. The Halloween night is a period of time when even...this is my story that happened on the Halloween night. You may believe me or not but...riddles! Complete 30 levels of riddles of the Halloween beautiful witch and find your way home through...
 
download free gamenightpuzzlehalloweenriddleall saintsboard
...Ireland. But unlike many pagan festivals and rituals, Halloween is celebrated on the last day of October,...the eve of All Saints` Day, is not forgotten and is very...popular today. Free Halloween Again screensaver with its inhabitants, no doubt, will...ghosts, mysterious mystical creatures, is there holiday of Halloween without them? Install this colorful screensaver and get...
 
free screensaverdownload screensaverhalloween againholidayhalloween screensavercartoons