1

Sort by : ReleasedNameDownloadsAddedRatingRelevance

Shareware by Inner-Smile.com
17 x 880Kb downloads

...of websites, emails or telephone calls directly from adress records are supported and even more!...
 
databasemanagementdisksstatisticsscheduleradressvideosprintoutlibrarybooksmanager
GlobeDNS Client

Freeware by Sascha Woestheinrich
11 x 1195Kb downloads

...Give your dynamic IP a static name and use this for a hole bunch of application scenarios. GlobeDNS will work with all dialup connections, like: smallband, ISDN and also broadband/...
 
domain name servercnameptrtxtfree dynamic dnsdownladisdnsrvnetwork servicesanalogdslrouterdyndnsmodem
Quick mac adress changer

Shareware by Paqtool Inc.
35 x 444Kb downloads

...Quickly change the mac address of your network cards...
 
changermacaddress
...Lotus Notes, Lotus Organizer, Combit Addressmanager or Cobra Adress Plus into your mobile. Supports Nokia 6230, 6230i,...
 
7250idesktop6310iwinfonie6810davidoutlookcobra20002002addresscombitpalmnokiamobile6270adress7210602060216230i2003infocentermicrosoftmanager20016610i5140itool6210tobitexpress880062806822
Agenda Mx 2005

Shareware by DEOUX Nicolas
12 x 5491Kb downloads

...Agenda MX was designed to let you manage your timetable in a simple and pleasant way. This diary also integrates a monthly calendar, an annual calendar as well as an...
 
agendaeventsnicolasdesigndeouxappointmentsanniversariescontactsolutionbookadresseasyorganizerdiarycalendar
Phone to Palm

Freeware by ballin technology
9 x 1220Kb downloads

...If you are using a Palm Handheld, sometimes you will went into a situation to transfer neutral address data into this device. Now, you can tranfer Excel data into the...
 
adressphonefreewarepalmoutlookhandheld
JOE - Joesoft Office Extension

Shareware by Joesoft
7 x 768Kb downloads

...Address and date management which can also manage tasks, letters, tables, notes and keywords. Contains a day- and weekview, remember funktions for tasks, dates and birthdays, an overview and a...
 
keywordremindernoteoverviewphonenumbertabledayviewdateweekviewpersonlettertaskcompanybirthdayadress
PingIT

Shareware by Desktop Software
11 x 198Kb downloads

...This program was developed for those people who want to know all the time about network loading, who wants to understand who is guilty of slow speed loading of internet...
 
portmonitorutilitiestrayserverstatussocketnetworksystemwebcheckwatcherpingitserviceicmploadingadresspinger
Zamzom Control

Freeware by Zamzom.com
6 x 721Kb downloads

...(url or ip address). Copy url or web adress that have been visit. Alert you by e-mail...
 
kidsparental controlchildmonitorsecurity
Business Contacts

Shareware by Dot4Soft
48 x 499Kb downloads

...Business Contacts 2.0 is a powerful address book containing best and new address books features. It will allow you to keep your contacts neatly and find information you need...
 
address bookaddressbookadress bookcontactscompanycompanies
OLMixedFolders

Shareware by Somebytes
3 x 2637Kb downloads

...by categories. It can also synchronize your global adress lists from Exchange (GAL)....
 
sharepointsynchronizegaloutlookoutlook 2007add-insubfolderwindows phoneicloudpdapublic folderblackberryactivesyncol2002iphonemobile phone
Free Vista Files award
...SyncFolder helps you to synchronize two or more folders/computers and to backup your important data. All sync-settings can be saved in a syncfolder-projectfile for later execution or...
 
synchronizationscheduled backup
...of mail systems, xTang has routines for importing adress books and old mails from outlook and outook...
 
e-mail explorer integratedspam protectionhtml mail
...TSconnect enables secured, safe and portable and RDP/TSE access from any PC without installation requirement. To enhance the security, all users settings are encrypted and wrapped into a single...
 
secured rdpunlimitedpasswordusb driveusb sticksafe tsesecured tselocksecured terminal services
...This plugin brings all your contacts to your television! The plugin integrates seemlessly into the Microsoft Windows Media Center Interface. The Media-Center part of the plugin can be navigated...
 
contactsadressmanageroutlook contactscontactmanagermedia center addressesmceaddress lookup
SCANFREE VERSION FREEWARE

Freeware by LANDPARK
3 x 280159Kb downloads

...Scanfree on its way to becoming the leading provider of professional inventory management software. Scanfree is a reliable, precise, and comprehensive professional supervision tool that performs real-time analysis to...
 
asset managementinventory tracking software
Terminal Service Plus

Shareware by Terminal Service Plus
1 x 124906Kb downloads

...and automatically TS WEB recognize automatically the server adress and the port number from the user broswer...
 
web access2003 sbs2008 sbshome workingrdcwindowsremote accessremoteappcitrixsecure rdphttpsuniversal printerrdp servermulti site
Scannet Pro

Shareware by Profiler3d
264 x 11118Kb downloads

...LAN,WAN and Internet.Online database for ports ore IP adress location.observing of all network releases, also all background...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
zFTPServer Suite

Freeware by Västgöta-Data AB
2 x 9152Kb downloads

...host name for a server with dynamic ip adress to use in passive mode, e.g. myserver.no-ip.com Powerful...IP-Access management: Access rights with respect to ip adresses or domain names may be specified, granting or...
 
ftpsactive directory integrationscripting friendlyipv6sftpsecure servertftphttps