Sort by : ReleasedNameDownloadsAddedRatingRelevance
ChrisPC Free Anonymous Proxy

Freeware by Chris P.C. srl
12 x 2939Kb downloads

...ChrisPC Free Anonymous Proxy is a powerfull software application with a friendly and ergonomic user interface that allows you to surf anonymously online and enjoy watching free TV and on-...
 
zattoohuluproxyfreechrispc free anonymous proxyfrancecbssyfyfoxwatchhide addresswilmaastreamnbcunblock websitesproxiesfree web proxyraiabcgeo blockedfree proxysecurity
XML Parser Software

Freeware by Website Design
15 x 712Kb downloads

...XML PAD extractor application provides a comprehensive XML development environment. Freeware PAD extractor software is a useful resource for webmaster and other technical person. Extractor software provides graphical user interface...
 
padfreewareinformationfilesextractionutilitywindowsstoresoftwarecsv file formattoolretrieveoperating systemsupportextractorurlfetchingxmldatapowerful
UpdateShield

Commercial by Sciensoft Research
1 x 11085Kb downloads

...HTTP and FTP Download - Get proxy IP address and port number from Internet Explorer (IE). -...
 
local update serverautomatic software updatecomponentcode protectionauto-updatenet encryptioncheck for updates
...Trace Route Wizard allows a programmer to trace the route a packet must take to get to any specified address(IP or FQDN). It is very intuitive and straight forward....
 
file controlhypertexttracerouteexamplesfree downloadtraceroute ocxprotocolsource codetraceroute activex
Clothing Store Invoice Template

Freeware by Uniform Software
1 x 37Kb downloads

...Clothing Store Invoice Template is ideal for those running clothing retailing shop or store business. On the heading section, the first section is for your own store or shop information,...
 
clothing store invoiceclothing shop invoiceexcel invoice template
...your e-mail policy, down to the individual e-mail address level. This means, you can even specify who...
 
email security serviceemail anti virusantispam filteremail softwarespam blockervirus removalanti spam softwarespam removalantivirusemail filteringspam prevention
Online Live Chat Software

Shareware by Partition Recovery
14 x 1146Kb downloads

Free Vista Files award
...Digital chat software offers interaction with visitors in real time and supply live assistance to visitors when they need help. Live chat script preserves trust, approval and confidence for sales...
 
messagesajaxclientcommunicationmessengerbrowseronlineconversationinternetsoftwarelive chataspweb chatutilitymanagescripttooltechnicalcustomersnet meetingflashaddressinstantsupportlookup
...Checklan Monitor SQL allows you to prevent outages on your servers, survey your applications, alerts you, automatically repairs by script and checks all that owns an IP address. Local installation...
 
inventaire informatiqueasset managementsoftware asset managementsystem inventoryadvisorinventory networkhipaaremoteauditnetwork software inventoryiavafisma
Free Vista Files award
...enter the RSS feed`s URL into Internet Explorer`s address bar and click Go, then the nicely formatted...
 
rdf feedrss feedatom readerrdf readerweb browseratom feedrss news feedrss toolxmlrss reader
VISCOM Digital Display Software

Shareware by Viscom Software
3 x 21213Kb downloads

...AV Manager is a Digital Signage, Multimedia display, Digital Video Management software which can operate multiple display units ( plasma, LED, LCD displays, VGA projectors and video walls) AV Manager supports...
 
digital signage softwarevideoplasmaaudioslide show
...With PolitMail, you can send from multiple email addresses -- any email address you can send from...
 
email marketing softwareemail templatesopen trackingemail trackingoutlook add-on softwarelist managementemail campaignsmailing listmail mergeemail newsletteremail lists
Advance Keyboard Monitor

Shareware by Hack Email Password
16 x 1638Kb downloads

...Advance stealth keyboard watcher program records all keystrokes and captures windows screen snapshot periodically and send it to user specified email ID. Invisible keyboard monitoring password protected software prevents external...
 
surveillancesoftwarekeystrokewatcherprogrampresstypedcaptureinvisiblekeyloggermonitoringrecordsantivirustooladvancestealthundetectedkeystrokeskeyboardactivitiesscreenshotpassword
Software602 Groupware Server

Shareware by Software602, Inc.
92 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging (XMPP) with searchable SQL based archive, web collaboration client...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
...Accent Composer simplifies the process of typing accented characters and other symbols into Windows programs. It lets you enter any character, in any program, with an easy-to-remember sequence...
 
accentsumlautspecial charactersdiacriticforeigndiaeresiscedilladieresissymbolsaccented charactershachekkeyboard
...Powerful software to make your cleaning business more efficient. Now you can easily record and view info on every cleaning job you have done: floor care, carpet care, self-employment,...
 
window washingcustodial trainingcarpet caremaid service softwarecleaning businessfloor carecleaner organizerbusiness organizercarpet cleaners softwarecleaning business softwareself-employment
...thing in my King log. What was the address of that page? Why haven`t you added it...to your bookmarks? I was guessing addresses as you do. But now I know that...all for me. Yes, it also logs the addresses of all the Web pages that you visit....
 
key loggerkeyboard loggerhardware keyloggerkeystroke recorderspy softwarekeycopykeystroke loggerkeyboard monitoringkeytrapinvisible keylogger
ManageBGL diabetes manager

Freeware by DataMystic
9 x 427Kb downloads

Free Vista Files award
...ManageBGL is a Simulated or Virtual insulin pump - only MUCH better! It provides cutting-edge tools for managing diabetes that NO OTHER SYSTEM can provide. ManageBGL is a sophisticated blood...
 
diabetic softwareshare diabetic logsdiabetes softwaretracking blood sugarmanage iddmdiabetic loggingmanage diabetesmanage type diabetes
...forgotten password of online shopping, web forms, billing address and magazine subscription. Outlook password rescue tool allows...
 
codeinformationrecoverygmaillogintoolutilityhiddensecretmultilingualserveraccountretrievemicrosoftrestoresoftwareapplicationexpressyahoooutlookunmaskemailasteriskforgottenpasswordextractreveallost
HSLAB Print Logger PE Gift Version

Freeware by Handy Software Lab
5 x 5001Kb downloads

...MS Standard TCP\IP port with the printer IP address as the port of the printer, or the...
 
print trackingplot trackingprinting securitytrack printingplot loggingprint accountingprint loggingprint auditingfax loggingprint quotaaudit printing
AcqURL

Shareware by GT Technologies
11 x 1074Kb downloads

...sites and local/network hard drives as well. To address this AcqURL includes an FTP client with a...
 
ftp clientbookmarkssearch enginebookmark manageracqurlverify links