1 2 3

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...to use iMacros please visit http://www.iopus.com/imacros/ and our active support forum at http://forum.iopus.com...
 
screen scrapinginternetflashregression testweb scrapingwshagentrecorderfillerautocompletefunctional testingautomatebatchform fillerscriptingsurfingrobotweb testing
Secure-It

Freeware by YASC LTD
60 x 712Kb downloads

Free Vista Files award
...Secure-It is a local Windows security hardening tool, proactively secure your PC by either disabling the intrusion...and propagation vectors proactively or simply reduce the attack surface by disabling...your Local Zone Security (My Computer) settings. * Proactively disable scripting or Active-X controls which proved potential...
 
windowsspywareproactivewormsfreewarehardeningvirusqwik fixsecurityqwick fix
Harden-It

Freeware by YASC LTD
33 x 433Kb downloads

...current malware, spyware, worm infection are completely blocked, proactively harden your system even against future uknown attacks....intrusion vectors by disabling non used services. · Proactively disable scripting or Active-X controls which proofed potential...
 
hardenstackhardeningsecuritytcpfreewaredenial servicewindowsprotect
Repellent

Freeware by Easy Desk Software
35 x 1633Kb downloads

...to know the signature. It simply disables the scripting capabilities. And to ensure that an Active Server...
 
virus
TERAVoice Server

Freeware by TERASENS GmbH
68 x 84670Kb downloads

...to understand programming interface for creation of custom Interactive Voice Response (IVR) application. Through its integrated scripting...
 
telephonypstnpbxtapiservergatekeepervbscriptsmsvoipteravoicemodemivrgatewayvoicemailbridgejavascriptmwidialogich323isdn
newObjects ActiveX Pack1 family

Freeware by newObjects
39 x 2590Kb downloads

...AXPack1 family is a huge non-visual ActiveX based run-time freeware library intended for scripting and...Windows based devices. In contrast to the most ActiveX libraries AXPack1 family`s first goal is to be...time consumming operations will be done by the ActiveX code, but leaving you complete freedom to construct...on binary, text, record (flat file) level. 2) Active script hosting and background threads running scripts. 3)...
 
sqlshortcutdatabasecomponentstoragejscriptfilethreadvbscriptcollectionlibraryrecordcryptographybinaryflataspstream

Shareware by Miraplacid
15 x 956Kb downloads

Free Vista Files award
...MSCCrypto is COM component for Active Server Pages and stand-alone applications. It includes collection...
 
linuxvisual basicchiliaspjavascriptsharewareactivexscripting hostcomponentsiisasp componentvbscriptfreewarechilisoftspice

Shareware by Miraplacid
17 x 884Kb downloads

Free Vista Files award
...MSCUpload is an Active Server File Upload component. It extentds standard Request...
 
spiceasp componentsharewarescripting hostcomponentsiislinuxvisual basicfreewarechiliaspvbscriptchilisoftactivexjavascript
Free Vista Files award
...Matching, CTags Support, CSE HTML Validator Integration, Integrated Scripting support, Integrated IE Browser support to show active...
 
syntax highlightinghtml editortext editorprogrammers editorhex editorphp editorultraeditbinary editorspell checker
FlyCharts

Shareware by Scand
17 x 528Kb downloads

...data. Now, using FlyCharts you can create compact, interactive and good-looking charts in a minute. FlyCharts doesn`t...need any installation, works with any scripting language, can be used in any browser, is...perfectly on low-speed connections. • Compatible with many scripting languages: FlyCharts is compatible with any scripting languages....on the client-side, it does not matter which scripting language is passing the data to the component....
 
phpgraphsaspnetflashperlhtmlgraphing componentjspchartsmacromediacgixmlswf
newObjects IE ScriptBar

Demo by newObjects
16 x 700Kb downloads

...interferring with each other. Can be integrated with Active Local Pages product to form powerful browsing companion...way you want. The run-time library included is ActiveX Pack1 Family. It includes almost everything the application...
 
scriptingtoolbartoolbandtool band
Code Chameleon

Shareware by C Point Pty Ltd
19 x 1958Kb downloads

Free Vista Files award
...and extensible editor supporting multitudes of programming and scripting languages: ActionScript, Active Server Pages (ASP), ADA, Apache,...
 
programming editortext editorformat codecode formatterscript editorcode beautifierhtml code editor
Routix NetCom

Freeware by Routix software
37 x 4949Kb downloads

...and over INTERNET connections. - support for remote scripting (with Microsoft Active Scripting) and provide useful remote...
 
routingtrafficfiltertcptraficaddressroutemacbandwidthbridgingudpnetcommonitoringroutixrarpqosurl blockingnetworkredirectionicsremote access
AY Mail

Shareware by aysoft.com
18 x 1208Kb downloads

Free Vista Files award
...HTML editor, HTML templates, mail merge, spell checker, active scripting, real time preview, flexible sending, scheduling, subscription...
 
htmlsslmail mergegroup emailfollow-upserversmtprecipientsmailing listbulk emailnewslettertargeted emailscheduling
Voice Insert ActiveX SDK

Shareware by Research Lab Inc
18 x 51888Kb downloads

...Point`n Speak with Read Aloud Target Support. XML Scripting Input for Limited Domain Grammar. Compact Instruction Set...Wave To Text operation. Server Side Execution or Active Server Page Samples for Subsequent Wave To Text...
 
sassdkmp3voice recognitionspeech textwave textwordvb6 apifree speech sdksapi
Text To Wave ActiveX Server DLL

Shareware by Research Lab Inc
19 x 9461Kb downloads

...Text To Wave ActiveX DLL allows programmers to convert any readable text...for Windows NT/2000/Advanced Server Server Side Execution or Active Server Page Samples, Chinese TTS Engine SAPI 5.1...
 
textaloudmp3text speechamplifylamesoxbladeecho reverseaudiovoice typefree formatfilterssoundgsmbitratefrequencytext wavefadespeech synthesistext mp3bit widthpcmnoisecompression
ActiveXperts SMS Messaging Server

Shareware by ActiveXperts Software
51 x 12752Kb downloads

...article database, a system to notify members of Active Directory OU’s, etc. VBScript is the default scripting,...to implement custom projects. The ActiveXperts SMS Mobile Messaging Server has a large install...stations, radio stations, network operators and e-commerce companies. ActiveXperts SMS Messaging Server received the `Product of the...
 
modemmmsgsmclickatellsmsgprssmppwavecomsmsc
Active Scripting Fast Disable

Shareware by Sparkleware
17 x 580Kb downloads

...Internet Explorer`s Active Scripting "feature" is responsible for popup windows, scrolling status...this technology for basic navigation, so permanently disabling Active Scripting is an impractical solution. The "Enable/Disable Active Scripting"...Our handy little tool makes disabling and enabling Active Scripting easy! With a single click or keypress, you...(including popup ads) * Check the state of Active Scripting in four different security zones *...
 
imagesecuritypopuppicturejavascriptdenydisablespaminternet explorerenableoutlookwindowtoolbarpopunderactive scripting
...a file change, or whether a window is active or inactive. Mark important appointments using alarms. LaunchPad...
 
scriptingautomatemacroautomationtask scheduler
Free Vista Files award
...AutoMate sets an entirely new standard for server and desktop automation. Built on the experience earned from delivering automation to more than 9000 sites across 40 countries, AutoMate 8 now...
 
accesswindowsmacroexcelscriptsintegrationsoftwaresftpbusinessautomationschedulingactive directoryapplicationenterpriseautomateautomaticbatchworkflowprogramautomatedunisynnetworkscriptingsnmpjob