1 2 3

Sort by : ReleasedNameDownloadsAddedRatingRelevance
ManageEngine Applications Manager

Freeware by ZOHO Corp.
106 x 49152Kb downloads

...application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and custom application monitoring. Applications Manager proactively...instances and the apps running in these instances. Services Monitoring feature monitors the health and availability of...the following services : JMX applications, Microsoft Exchange Server, Service Monitoring...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
Adventnet ManageEngine ServiceDesk Plus

Freeware by AdventNet Inc
189 x 37002Kb downloads

...ManageEngine ServiceDesk Plus is a web based, easy to use...and Knowledge base in one low-cost, easy-to-use package, ServiceDesk Plus gives you the ability to improve productivity...of your IT Service team and keep your end-users happy. ServiceDesk Plus...to common problems in an online knowledge base. ServiceDesk Plus offers accurate inventory tracking functionality across Windows...of over-utilized or under-utilized licenses across your organization.
 
helpdesk softwareservice deskcontract managementitil help desktrouble ticketingsla managementinventory managementknowledge basepurchase order managementasset management
ManageEngine Desktop Central

Commercial by ZOHO Corp.
149 x 104448Kb downloads

...Administration, Software Deployment, Creating Software Repostories, Patch Management, Service Pack Deployment, Asset Management, Warranty Tracking, Remote Control,...Configurations, Active Directory Reports, User Logon Reports and Windows System Tools....the administrator can easily manage any networks like Active Directory, Workgroup & Novell eDirectory. Key Features Supports...
 
warranty trackingremote desktop managementconfigurationspatch managementmobile device managementsoftware deploymentdesktop administrationinventory managementactive directory reportsrole based administrationpower management
SkyFex Remote Desktop

Freeware by Tomsk, Inc.
88 x 2016Kb downloads

Free Vista Files award
...Remote Desktop is a free online remote desktop service that allows watching and controlling remote computers in...required to use it. SkyFex is a secure service for remote support solutions and help desks. It...- Updates upon browser start, - Deployment via Active Directory, - Reverse screen sharing (great for online...
 
remote destopdesktop streamingremote accesshelp desk softwareremote assistancedesktop sharingremote supportonline collaborationremote desktop controlremote solutionremote support softwareremote control
Cerberus FTP Server

Shareware by Cerberus, LLC
40 x 7721Kb downloads

Free Vista Files award
...and can quickly be configured to authenticate against Active Directory and LDAP. It can run as a...Windows service or standalone, has native x64 support, includes a...
 
securecerberussftpftpestlsftpsserversslhttphttps
ORF Enterprise Edition

Commercial by Vamsoft Ltd.
23 x 3573Kb downloads

...e.g. regular expression-supported keyword filtering, attachment filtering or Active Directory-based recipient validation. Using the self-learning Automatic Sender...be used with Windows 2000/2003 built-in IIS SMTP Service and Microsoft Exchange 2000/2003 Servers (which use this...
 
dnsblanti-spamopen relayexchangespam filteremail filterrbl
Chroniker for Availability Monitoring

Demo by NRG Global
17 x 24377Kb downloads

...DNS, Mail Server, LDAP Server, Network File Copy, Active Directory, and Custom Test Features and Capabilities Network...Predefined essential reports in real time: Top N, Service Level, Agreement (SLA) Daily / Monthly / Yearly...
 
log managementcitrix monitoring softwarenetwork monitoringavailability monitoringsystem monitoringdatabase monitoringwebserver monitoringserver uptimebusiness dashboardsapplication response time
GFI Network Server Monitor

Shareware by GFI Software
16 x 13312Kb downloads

Free Vista Files award
...Actions, such as rebooting a machine, restarting a service or running a script can be done automatically....CPU usage, FTP & HTTP Servers Group Membership, Active Directory & NTDS, Disk Drive health, Disk Space,...Network Server Monitor tests the status of a service by actually logging on, testing and logging off,...rather than deducing a service status from generated events (as other products do),...
 
exchange servernetwork monitorsqlnetwork monitoringoracleserver monitoring
Free Vista Files award
...(SNMPv1 and SNMPv2c) and NetBIOS . Support for Active Directory, ADSI, CPU Usage, directories, disk health, DNS,...
 
network managementinternet solutionsnetwork monitordiagnostic softwareinternet softwarenetwork server monitornetwork server software
ActiveXperts SMS Messaging Server

Shareware by ActiveXperts Software
50 x 12752Kb downloads

...volume. Support for GSM/GPRS modems, SMPP and HTTP service providers and e-mail. Integrates with MS Access, MS...article database, a system to notify members of Active Directory OU’s, etc. VBScript is the default scripting,...to implement custom projects. The ActiveXperts SMS Mobile Messaging Server has a large install...stations, radio stations, network operators and e-commerce companies. ActiveXperts SMS Messaging Server received the `Product of the...
 
modemmmsgsmclickatellsmsgprssmppwavecomsmsc
RBackup for Online Backup Services

Demo by Remote Backup Systems
22 x 97954Kb downloads

Free Vista Files award
...level), multiple instances of SQL Server, System State, Active Directory, Hyper-V, VMWare, Full Drive Images, normal files...
 
remote backupweb backupinternet backuponline backuprbackup
BackupAssist

Shareware by BackupAssist
20 x 21407Kb downloads

...users to backup files, folders, system state and Active Directory. Drive imaging functionality with hardware-independent, bare-metal restoration...BackupAssist can make life much easier for I.T. Service Providers by helping consolidate client accounts and multiple...
 
windows backup softwareremote backuptape backup softwarebackup schedulingnetwork backupsdvd backupslaptop backupsdatabase backupssmall business backupsbackup assistntbackupschedule backupsserver backup softwaretape rotation
VeraLab

Commercial by VeraLab Inc.
21 x 49356Kb downloads

...means to identify abusers. Increased availability of workstations: Service tickets can be tracked and collaborated upon to...
 
softwarecomputermanagementsystemlicensereportssecuritycontrollocksurveillancemaintenancemonitoringaccessworkstationcheck-inmeteringlearning
NTSet

Shareware by SaM Solutions
33 x 3134Kb downloads

...network resources and connected devices; - Monitor terminal service sessions; - Schedule tasks for execution on network...Configure group policies on standalone computers or in Active Directory; - Browse for existing group policy objects;...- Browse for Active Directory containers. Please note: the provided version supports Delphi...
 
task scheduleregistrygroup policiessharingwindows 2000terminal adminactive directory containerssend messagesservicesserver infodelphiusermanbrowse networksprivilegesevent logfirewall configuresecurity
Windows Password Expert

Shareware by AtlantisMinds
42 x 1055Kb downloads

.../XP/ 2003 Passwords if Administrator password is lost. Active Directory/Domain Controllers are supported Features 100% recovery rate...Professional, Server and Advanced Server are supported All Service Packs are supported Supports creation of preinstallation disk(Supports...
 
analyserrecoveryexpertfreewpereset passwordlost password
...•Fully Web and Notes Client enabled •End User Self Help Interface •Custom Personal Settings Analyst and Manager...hardware and software information •Dynamically pull information from Active Directory •Configure auto-notification/progress updates to End Users •Auto-Escalate...Ticket is endanger of being Escalated •Set up Service Level Agreements for VIP(s) •Associate similar tickets for...
 
lotus notes help deskknowledge basehelpdeskasset management
Free Vista Files award
...Windows Vista, Windows 7 and Windows 2008 compatible service that interacts with the underlying Windows Eventlog subsystem...as the new DNS, File Replication Service, and Active Directory logs are supported. Log data is converted...
 
collectionsyslogeventlog
Polar Help Desk

Demo by Polar
25 x 17183Kb downloads

...incident management enables your organization to manage support services to your employees and customers through a central...of customer, accounts, teams, incidents, email mailboxes - Service Level Management. Use best practices from ITIL. -...- Custom Languages and customization any labels - Active Directory integration - API that lets you integrate...
 
help desk softwarecustomer support softwarehelpdesk systemtrouble ticketcomputer technical supporthelpdesk softwareweb based help deskonline technical support
winfingerprint-0.6.2.zip

Freeware by Kirby Kuehl
45 x 937Kb downloads

...can choose to perform a passive scan or interactively explorer network shares, map network drives, browse HTTP/FTP...Additional features include NULL IPC$ Sessions, detection of Service Pack and Hotfixes, ICMP and DNS Resolution, OS...detection and much more. Winfingerprint can utilize Active Directory (ADSI) or Windows Management Instrumentation (WMI) interfaces in...
 
netbioswmiwindows enumeration toolssmbadsi
WWW File Share Pro

Shareware by LionMax Software
23 x 3396Kb downloads

Free Vista Files award
...to do is to simply specify a download directory and a upload directory. Then run the internet...password protection, default document, NT service, Ban IP, active connections monitor, etc....
 
file share softwaredisk sharefile sharingwww file share pro