1 2 3

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...feeds, public folders, contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online document sharing into a rich...provides real-time, two-way synchronization of mail, contacts, tasks, calendar events, notes and journal items between Outlook (2002/2003/2007)...from a browser, FTP/FTPS client, or WebDAV folder. Active Directory synchronization provides easy integration with existing directory...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Desktop Calendar

Freeware by BestShareware.Net
541 x 286Kb downloads

...Desktop Calendar is a free desktop enhancement program which can...add a calendar and to-do-list to your computer`s desktop. Everyday when...powered on your computer, you will see a calendar on your desktop with your full control. You...you may schedule your to-do-list. This freeware features active calendar,intuitive to-do-list and customizable background and text colors....
 
dailiy activitiesnotesschedulerdesktop calendartask alarms
Mediabee Family Dashboard

Freeware by Mediabee
95 x 6461Kb downloads

...Communicate better and increase harmony with your family and group. Plan and track everyone's schedules and to-dos in one place. Easily access from anywhere. Get cell phone...
 
active desktopwall plannerfamily portalfamily dashboardday plannerfamily calendarfamily organizergroup calendargroup organizergroup plannershared calendar
Titlebar Date

Freeware by Titlebar Software
25 x 172Kb downloads

...week and date in the titlebar of the active window. Titlebar Date`s executive file is a very...
 
calendartitlebar
Titlebar Time

Freeware by Titlebar Software
27 x 172Kb downloads

...and the time in the titlebar of the active window. Titlebar Time`s executive file is a very...
 
calendartitlebar
...feature, special effects, and much more. Use the Active Desktop feature and have your calendar and clock...
 
changermasksgraphicswindowswall-paperpuzzlecalendarmanagedisplaymanagerwallpapernotesimages
Wallpaper Sequencer Ultra

Shareware by Draxysoft
59 x 4384Kb downloads

...resolutions - the program fits everything automatically. Add Active Desktop support and Taskbar transparency to that and...
 
softwaretransparencyclockstaskbarslideshowsequencerdesktop clockwallpapericonscalendarchangermanager

Shareware by WiredPlane.com
62 x 3590Kb downloads

...your background image via customizable templates (interactive clickable calendar on desktop, picture mixer, memo pad and more)...images. Another template transforms your image into handy interactive calendar for 2 weeks or a current month with...
 
wallpaper changerinteractive desktopactive calendardesktop notesblendembossdesktop clockscalendar desktopslide show screensaverdispositionimage effects
Active Suite

Shareware by Actives Softwares
55 x 28362Kb downloads

...is a set of 3 parts : - Active WallPaper which will display your photos on the...processing algorithms, your photos will always be optimized. Active WallPaper can display all standard photo format, and...you don`t need to activate Active Desktop. You can manage up to 3 different...and switch between them with a single click! Active WallPaper also contains an calendar that will remind...village bell-tower, Cathedral, grand-father clock, Swiss Cuckoo).
 
slidechangercalendarimageretouchautomaticwallpaperbackgroundsharewaredesktopdailyphotopictureshownotealarme
Active Wallpaper Changer

Shareware by ABF software, Inc.
66 x 2796Kb downloads

...try something new? Want to have an adjustable calendar highlighting holidays, birthdays and other important dates on...download new high-quality wallpapers from the Internet? Then Active Wallpaper Changer is for you! Using Active Wallpaper...Changer you can: - Place a flexible adjustable calendar on your desktop, highlighting holidays, birthdays, other important...popular graphical file formats as wallpapers without enabling Active Desktop.
 
backgroundwallpapercalendardesktopchanger
ABF Wallpaper Changer

Shareware by ABF software, Inc.
71 x 2797Kb downloads

...try something new? Want to have an adjustable calendar highlighting holidays, birthdays and other important dates on...Changer you can: - Place a flexible adjustable calendar on your desktop, highlighting holidays, birthdays, other important...popular graphical file formats as wallpapers without enabling Active Desktop. You can find the full list of...
 
changerpicturecalendardesktopwallpaperautomaticallyabf
...settings, edit domain and user accounts and view active sessions using the web based configuration menu. A...
 
calendarisapigroupwarewebmailsmtppop3email
Active Desktop Calendar

Shareware by XemiComputers Ltd.
99 x 5627Kb downloads

Free Vista Files award
...This fully customizable calendar with notes, tasks, alarms and contacts provides seamless...its appointments and tasks on the desktop. Preset calendars with holidays for many different countries are included,...too. There are options for changing calendar icons, fonts and colors, marking weekdays of choice...can have a text only version of the calendar and choose between displaying one, two or three...stand alone or attached to a note.
 
recurring appointmentswallpaperpersonal information managerorganizertasksschedulerprintdata sharingxemicomputersalarmsactive desktop calendaraddress booknotespimcontactsrecurrencelanicons
...work periods and they show up in the Active list automatically. Total worklog by task or date...keeps your diary too. Show contact and resource calendars by day(s), week or month. Intelligent task completion...logic shows cancelled appointments automatically. Calendar color coding highlights up-coming and late appointments. Intuitive...
 
pimtime trackingoutlook syncresource schedulingproject management
Smart Reminder

Shareware by Smart Reminder
30 x 5014Kb downloads

...and anniversaries, appointments and meetings. * Your personal calendar is only one click away, showing reminders for...
 
alertsaddress bookappointments reminderyahoocustom recordsgenerate web pagesholidaysbackupcontactssoftware organizertaskspimreminderscontact manageralarmseventsoutlookbirthday remindergroupslists
Screen Calendar for Outlook

Shareware by FeatherySoft
30 x 2013Kb downloads

Free Vista Files award
...Screen Calendar for Outlook really allows you to put the...calendar on your desktop wallpaper choosing the calendar size and transparency. Double-click a calendar to schedule...over the date cell. Also, your records and calendar can be printed. So, your PIM is always...especially if you like to use the hide/show calendar commands. Screen Calendar for Outlook lets you to:...
 
notedesktop imagedaterandom backgroundwinamp skinpickwalpapersdesktop wallpaperscreencalendarprint calendardesktop calender
DaanCalendar

Shareware by DaanSystems
23 x 110Kb downloads

...for each day of a month. Publish the calendar to a webpage and an active reminder are...files). - Simple exporting to Excel. - Simple active reminder system. - I nsert events for as...mousewheel to change months. - Includes an example calendar with holidays from all over the world....
 
calendareventsscheduling
...screensaver runs only during breaks in your work! Active Desktop will work simultaneously with you! It will...Internet in searches desktop wallpaper any more! Download active desktop and you will receive everything, that it...
 
dynamicallydirectxdesktop-toolsnetsupalovdigitalactivewallpaperandreysystemscalendarestatemultimediaprogramsharewarescreensaver
OrgScheduler LAN

Shareware by Binary-House Software
33 x 10123Kb downloads

Free Vista Files award
...way for any organization to have a networking calendar within minutes! Calendar management is implemented at two...The program will show the complete list of active connections. The OrgScheduler LAN is built upon the...friends and family members. You can format the calendar according to your regional settings. It provides many...
 
plannerorgschedulerlannetwork calendarlan calendartimelinereminderoutlookschedulingorgscheduler lanassistant managerorganizerpersonal

Shareware by Educe Software
24 x 56Kb downloads

...Calendar V 2.x.x c) 1999-2000 Educe RegisterCalendar@educesoft.com. ABOUT: Calendar provides an interactive interface in the form of...in a MS Access 2000 database file. The calendar can be maintained remotely using the tools provided....INSTALLATION: The ISP must support Active Server Page (ASP) and have ActiveX data objects...
 
intranetdatabasesoftwareappointmentonlinedateaspsolutionautomaticjavascriptaccessvbscriptallocationsharewarecustomiseinformationwebinternetbusinessotsresourcemonthcalendarapplicationutility