1 2 3 4 5 6 7 8 9 ... 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Web Based IBN HelpDesk

Shareware by Mediachase Russia
4 x 31980Kb downloads

...our clients as a powerful tool for 24/7 service as well as support organization and call-center providing....With Instant Business Network you get a unique program that enables both efficient collaboration and incident management...a single integrated environment. IT departments, product departments, services departments or any organization with more than a...our clients as a powerful tool for 24/7 service as well as support organization and call-center providing.
 
web based helpdeskbug trackeronline issue trackerincident management system
...designed for fireman, dispatcher, call enter staff, emergency service staff and law enforcement officers, pupils, students and...teachers, doctors, volunteer groups, churches, security services and police officers, soldiers etc. It will help...competently organized schedule for the whole staff. The program enables users to switch between profiles to view...old archives automatically. This modern and extremely handy program makes schedule management a real pleasure.
 
organizerschedulingappointmentsrosteringpolice softwarevolunteer softwareplannerschedulerstaff schedulingpupils softwarestaff rosterroster softwarefireman softwarecalendarclass rosterstaff schedulerdispatcher software
...Hardware Inspector Service Desk is a valuable extension for Hardware Inspector...data source for reporting on performance of the Service Desk staff and reliability of particular assets. Each...to sort requests by various parameters. Hardware Inspector Service Desk is fully customizable. Administrators can change values...large variety of support policies in organizations. The program features automated assignment of responsibilities for request processing....
 
ticketsservice requestshelpdeskservice deskincident management
...where it is installed. Main purpose of the program - collection of the information about sizes (in...about printing activity. As enterprise level software, The program allows you remote access to the statistics using...at a color printing), costs for repair and service for printers....
 
printing securityplot trackingtrack printingfax loggingaudit printingplot loggingprint loggingprint trackingprint quotaprint accountingprint auditing
...Lawyers Service combines powerful case management tools for organizing clients,...mail, e-mail, phone calls and much more. Lawyers Service is designed to help you effectively keep track...to a successful conclusion. A comprehensive solution, the program allows creating the database and events planned. It...many comments as you wish, including pictures. The program gives you a customizable Date Navigator and comprehensive...
 
advocate softwarejudge softwarelegal casecase factssoftware for lawyers diaryorganizesoftware for advocatelawyers softwareattorneyhelpersworksheetsnotarylawyer organizernotaries software
VideoAuthor

Freeware by Protectedsoft Ltd.
4 x 11377Kb downloads

...VideoAuthor is a professional program package for video editing. It includes functions to...Youtube and many more. Also, you get a service for uploading and storing your video files on...
 
convertervideo
GPS Tracker Data Logger

Shareware by AGG Software
2 x 11814Kb downloads

...a log file or a database. Also, the program has a set of interfaces so other applications...with the help of integrated client software. Our program allows you to reduce the amount of client...Tracker Data Logger can also run as a service under Windows 2000 and higher; * It runs...
 
vehicle trackergps tracker loggergps loggervehicle position monitoring
Invoice Manager

Shareware by Hillstone Software
8 x 5878Kb downloads

...invoices, credit notes, delivery notes. Customer, product and service database, supports barcode reader, email, PDF, letters, labels,...statements. - Quotations and Invoices support product and service layout - Use product quotations and invoices with...
 
accounts softwarebilling programinvoice makeraccounts programaccounting programstock controlbilling softwareinvoice programaccounting softwareinvoice softwarebook keepinginvoicingsuppliers
TimeLive Full Version with source code

Commercial by OlyKit, Inc.
6 x 1723Kb downloads

...products delivers a time tracking solution for professional service providers. Each of our products has been designed...time tracking needs of specific segments of the service provider market, including both time tracking and time...
 
downloadableonline timesheettimesheetstimesheet programhostedonline time sheettime trackingweb timesheetemployee time sheettimesheet systememployee timesheettime and billing solution
Automatic craigslist ad software

Freeware by Rain-clouds.com
44 x 6728Kb downloads

...ads to promote your business or product. The program can also be found at http://www.rain-clouds.com and registered...
 
classified placing softwareadvertising softwarecraigslist softwarecraigslist posting softwarefree marketing softwarecraigslist posterfree posting
IsItUp Network Monitor

Shareware by Taro Software Inc.
3 x 14949Kb downloads

...Monitor, Web site Monitor, Tcp/Ip Port Monitor, Windows Service Monitor,Disk Free space Monitor and an e-mail System...of a user defined program. A failed windows service may be restarted as well. The Web site...
 
alertsmonitorserver monitorbeeperwindows service monitorpagerwebsite monitortcpipport monitoremail monitorweb server monitormapinetwork monitorpingdisk free space monitoremail notification
...SMS into their IT system. After installation, the program lets you search for a 3G or GSM...supports the SMPP protocol or the Clickatell SMS service to send messages over an Internet connection. The...
 
pagingpagerhttpclickatellsnppsmswctpsqlsmpptapmodemvisual basicemailgsmucp
Advanced Task Scheduler

Shareware by Southsoftware.com
5 x 46771Kb downloads

...on dial-up connection being established, on user log-on/off, program start/stop, etc. Popup messages stop you forgetting important...set time, and a similar feature applies to programs and dial-up networks. Advanced Task Scheduler icons will...scheduler can also be started as a Windows Service and work in the background, enabling all scheduled...
 
scheduleprogrambootdialrebootturn offapplicationrunauto-dialautomateschedulingkill processreminderstartschedulertasknetwork
Vista TuneUpSuite

Shareware by Windsty, Inc.
3 x 1360Kb downloads

...removing unwanted applications and broken Registry links. * Service Manager It offers interactive way to configure services...ones you don’t need. * Startup Manager This program offers a solution for taking control of the...
 
windows vista tweakwindows vista recoverywindows vista configurewindows vista tunewindows vista optimizerwindows vista diagnosticwindows vista speedwindows vista manager
Windows 7 TuneUpSuite

Shareware by Windsty, Inc.
6 x 1376Kb downloads

...Disk Space Analyzer is an easy to use program that can help you to analyze disk space...uninstalling utility with many cleaning tools included. * Service Manager Service Manager offers interactive way to configure...drivers. * Startup Manager Take control of the programs that are loaded during Windows startup....
 
windows optimizerwindows managerwindows tweakwindows tunewindows recoverywindows configurewindows speedwindows diagnostic
TimeLIve Web Basic Version (25 Users)

Commercial by OlyKit, Inc.
2 x 1723Kb downloads

...products delivers a time tracking solution for professional service providers. Each of our products has been designed...time tracking needs of specific segments of the service provider market, including both time tracking and time...
 
employee time sheetdownloadableonline time sheetonline timesheettimesheetstimesheet programemployee timesheetweb timesheettime trackingtime and billing solutiontimesheet systemhosted
...of converting beyond your expectations., high quality email service and 100% 30-day money back Guarantee. It`s the...
 
converting toolvideo converterconverting softwareconvert videovideo formats converterconvert many formats
...was selected by Adobe to launch a new service at their annual conference. The time software continues...
 
easytttasksgraphswidgettime tracking time clockchartsclientswindowsdesktop timerexportremindersdesktop clocktrack timeprojectsexcelbill ratexmlstopwatchadobetimesheetdesktop stopwatchmac
...SMS into their IT system. After installation, the program lets you search for a 3G or GSM...or Cinterion. Another option is the Clickatell SMS service to send messages over an Internet connection. The...
 
smshttpsqlmodememailvisual basicgsmclickatell
A-PDF Watermark Service

Shareware by A-PDF.com
3 x 3913Kb downloads

...A-PDF Watermark Services is a windows services program which can run in the background to add...to PDF files automatically. You can use the service to batch add text, image, graphic watermarks to...existing Acrobat PDF files in sequence. A-PDF Watermark Services can watch multiple folders at the same time...
 
logopdftextgraphicbate numberstamp numberpicturesmacrowatermarkimageadobewindows services program